PPAP2B Antibody


Immunohistochemistry-Paraffin: PPAP2B Antibody [NBP1-82825] - Staining of human thyroid gland shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

PPAP2B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSF
Specificity of human PPAP2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPAP2B Protein (NBP1-82825PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PPAP2B Antibody

  • Dri42
  • EC
  • lipid phosphate phosphohydrolase 3
  • LPP3PAP2 beta
  • MGC15306
  • PAP2b
  • PAP-2b
  • PAP2-beta
  • Phosphatidate phosphohydrolase type 2b
  • Phosphatidic acid phosphatase 2b
  • phosphatidic acid phosphatase type 2B
  • type-2 phosphatidic acid phosphatase-beta
  • vascular endothelial growth factor and type I collagen inducible
  • Vascular endothelial growth factor and type I collagen-inducible protein
  • VCIP


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for PPAP2B Antibody (NBP1-82825) (0)

There are no publications for PPAP2B Antibody (NBP1-82825).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPAP2B Antibody (NBP1-82825) (0)

There are no reviews for PPAP2B Antibody (NBP1-82825). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PPAP2B Antibody (NBP1-82825) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PPAP2B Products

Bioinformatics Tool for PPAP2B Antibody (NBP1-82825)

Discover related pathways, diseases and genes to PPAP2B Antibody (NBP1-82825). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPAP2B Antibody (NBP1-82825)

Discover more about diseases related to PPAP2B Antibody (NBP1-82825).

Pathways for PPAP2B Antibody (NBP1-82825)

View related products by pathway.

PTMs for PPAP2B Antibody (NBP1-82825)

Learn more about PTMs related to PPAP2B Antibody (NBP1-82825).

Research Areas for PPAP2B Antibody (NBP1-82825)

Find related products by research area.

Blogs on PPAP2B

There are no specific blogs for PPAP2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPAP2B Antibody and receive a gift card or discount.


Gene Symbol PPAP2B