PPAP2B Antibody - BSA Free

Immunohistochemistry-Paraffin: PPAP2B Antibody [NBP1-82825] - Staining of human thyroid gland shows moderate cytoplasmic and nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PPAP2B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PPAP2B Antibody - BSA Free (NBP1-82825) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSF
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLPP3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PPAP2B Protein (NBP1-82825PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PPAP2B Antibody - BSA Free

• Dri42
• EC 3.1.3.4
• lipid phosphate phosphohydrolase 3
• LPP3PAP2 beta
• MGC15306
• PAP2b
• PAP-2b
• PAP2-beta
• Phosphatidate phosphohydrolase type 2b
• Phosphatidic acid phosphatase 2b
• phosphatidic acid phosphatase type 2B
• type-2 phosphatidic acid phosphatase-beta
• vascular endothelial growth factor and type I collagen inducible
• Vascular endothelial growth factor and type I collagen-inducible protein
• VCIP

Background

The protein encoded by the PPAP2B gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. Alternatively spliced transcript variants encoding the same protein have been described. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLPP3