PP2A alpha/beta Antibody (4J2Z8)

Western Blot: PP2A alpha/beta Antibody (4J2Z8) [NBP3-16634] - Western blot analysis of extracts of various cell lines, using PP2A alpha/beta Rabbit mAb (NBP3-16634) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunohistochemistry-Paraffin: PP2A alpha/beta Antibody (4J2Z8) [NBP3-16634] - Immunohistochemistry of paraffin-embedded human lung cancer using PP2A alpha/beta Rabbit mAb (NBP3-16634) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/Immunofluorescence: PP2A alpha/beta Antibody (4J2Z8) [NBP3-16634] - Immunofluorescence analysis of NIH-3T3 cells using PP2A alpha/beta Rabbit mAb (NBP3-16634) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: PP2A alpha/beta Antibody (4J2Z8) [NBP3-16634] - Immunofluorescence analysis of C6 cells using PP2A alpha + beta Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: PP2A alpha/beta Antibody (4J2Z8) [NBP3-16634] - Immunofluorescence analysis of U-2 OS cells using PP2A alpha + beta Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: PP2A alpha/beta Antibody (4J2Z8) [PP2A alpha/beta] - Immunofluorescence analysis of C6 cells using PP2A alpha + beta Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: PP2A alpha/beta Antibody (4J2Z8) [PP2A alpha/beta] - Immunofluorescence analysis of U-2 OS cells using PP2A alpha + beta Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 4J2Z8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PP2A alpha/beta Antibody (4J2Z8) Summary

• Description: Novus Biologicals Rabbit PP2A alpha/beta Antibody (4J2Z8) (NBP3-16634) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-309 of human PP2A alpha/beta (P62714). WSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PPP2CA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PP2A alpha/beta Antibody (4J2Z8)

• PPP2CA
• PPP2CB
• Replication protein C
• RP-C
• serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
• serine/threonine-protein phosphatase 2A catalytic subunit beta isoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP2CA