Recombinant Human POU3F3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human POU3F3 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 401 - 500 of Human POU3F3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTSVQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
POU3F3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human POU3F3 Protein

  • brain-1
  • Brain-specific homeobox/POU domain protein 1
  • Brn-1
  • BRN1brn-1
  • Oct-8
  • Octamer-binding protein 8
  • Octamer-binding transcription factor 8
  • OTF-8
  • OTF8oct-8
  • POU class 3 homeobox 3
  • POU domain class 3, transcription factor 3
  • POU domain, class 3, transcription factor 3

Background

POU3F3 - POU domain, class 3, transcription factor 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61436
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-89934
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58020
Species: Hu
Applications: ICC/IF
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
423-F8/CF
Species: Hu, Mu
H00005452-D01P
Species: Hu, Mu, Rt
Applications: WB
AF2567
Species: Mu
Applications: WB, IHC
NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-85410
Species: Hu
Applications: IHC, IHC-P
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85823
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP1-57622
Species: Hu
Applications: WB, IHC, IHC-P
H00005455-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for POU3F3 Partial Recombinant Protein (H00005455-Q01) (0)

There are no publications for POU3F3 Partial Recombinant Protein (H00005455-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POU3F3 Partial Recombinant Protein (H00005455-Q01) (0)

There are no reviews for POU3F3 Partial Recombinant Protein (H00005455-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POU3F3 Partial Recombinant Protein (H00005455-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POU3F3 Products

Bioinformatics Tool for POU3F3 Partial Recombinant Protein (H00005455-Q01)

Discover related pathways, diseases and genes to POU3F3 Partial Recombinant Protein (H00005455-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POU3F3 Partial Recombinant Protein (H00005455-Q01)

Discover more about diseases related to POU3F3 Partial Recombinant Protein (H00005455-Q01).
 

Pathways for POU3F3 Partial Recombinant Protein (H00005455-Q01)

View related products by pathway.

PTMs for POU3F3 Partial Recombinant Protein (H00005455-Q01)

Learn more about PTMs related to POU3F3 Partial Recombinant Protein (H00005455-Q01).

Blogs on POU3F3

There are no specific blogs for POU3F3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
POU3F3 Antibody
NBP1-49872
ZEB1 Antibody
NBP1-05987

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human POU3F3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POU3F3