Polypeptide GalNac Transferase 3/GALNT3 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GALNT3. Source: E. coli
Amino Acid Sequence: EESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHC Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
GALNT3 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81849. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Polypeptide GalNac Transferase 3/GALNT3 Recombinant Protein Antigen
Background
GALNT3, also known as Polypeptide N-acetylgalactosaminyltransferase 3, has a 633 amino acid long isoform that is 73 kDa and a short 192 amino acid isoform that is 22 kDa; is located in the Golgi apparatus; plays a central role in phosphate homeostasis; acts as a catalyzer in the initiation of O-linked oligosaccharide biosynthesis, and the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor; shows an activity toward HIV envelope glycoprotein gp120, EA2, Muc2 and Muc5; and glycosylates FGF23, and probably fibronectin in vivo too. Studies on this protein have shown a relationship with the following diseases and disorders: tumoral calcinosis, hyperphosphatemic calcinosis, hyperostosis-hyperphosphatemia syndrome, hyperphosphatemic familial tunoral calcinisis, normophosphatemic familial tumoral calcinosis, testicular microlithiasis, bile duct carcinoma, periostitis, squamous cell carcinoma, diabetes mellitus, colon adenocarcinoma, lung adenocarcinoma, pancreatic cancer, metabolic disorders, and lung cancer. This protein has also been shown to have interactions with CIGALT1, CIGALT1C1, ST6GALNAC1, B3GNT6, and GCNT1 in pathways such as O-linked glycosylation of mucins, metabolism of proteins, and post-translational protein modification.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC
Species: Mu
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: ChIP, ICC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for Polypeptide GalNac Transferase 3/GALNT3 Protein (NBP1-81849PEP) (0)
There are no publications for Polypeptide GalNac Transferase 3/GALNT3 Protein (NBP1-81849PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Polypeptide GalNac Transferase 3/GALNT3 Protein (NBP1-81849PEP) (0)
There are no reviews for Polypeptide GalNac Transferase 3/GALNT3 Protein (NBP1-81849PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Polypeptide GalNac Transferase 3/GALNT3 Protein (NBP1-81849PEP) (0)
Additional Polypeptide GalNac Transferase 3/GALNT3 Products
Blogs on Polypeptide GalNac Transferase 3/GALNT3