Polypeptide GalNac Transferase 3/GALNT3 Recombinant Protein Antigen

Images

 
There are currently no images for Polypeptide GalNac Transferase 3/GALNT3 Protein (NBP1-81849PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Polypeptide GalNac Transferase 3/GALNT3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GALNT3.

Source: E. coli

Amino Acid Sequence: EESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GALNT3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81849.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Polypeptide GalNac Transferase 3/GALNT3 Recombinant Protein Antigen

  • EC 2.4.1.41
  • GalNAc transferase 3
  • GalNAc-T3
  • GalNAc-T3DKFZp686C10199
  • GALNT3
  • HFTC
  • HFTCMGC61909
  • HHS
  • HHSPolypeptide GalNAc transferase 3
  • polypeptide GalNAc-transferase T3
  • polypeptide N-acetylgalactosaminyltransferase 3
  • pp-GaNTase 3
  • Protein-UDP acetylgalactosaminyltransferase 3
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 3 (GalNAc-T3)

Background

GALNT3, also known as Polypeptide N-acetylgalactosaminyltransferase 3, has a 633 amino acid long isoform that is 73 kDa and a short 192 amino acid isoform that is 22 kDa; is located in the Golgi apparatus; plays a central role in phosphate homeostasis; acts as a catalyzer in the initiation of O-linked oligosaccharide biosynthesis, and the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor; shows an activity toward HIV envelope glycoprotein gp120, EA2, Muc2 and Muc5; and glycosylates FGF23, and probably fibronectin in vivo too. Studies on this protein have shown a relationship with the following diseases and disorders: tumoral calcinosis, hyperphosphatemic calcinosis, hyperostosis-hyperphosphatemia syndrome, hyperphosphatemic familial tunoral calcinisis, normophosphatemic familial tumoral calcinosis, testicular microlithiasis, bile duct carcinoma, periostitis, squamous cell carcinoma, diabetes mellitus, colon adenocarcinoma, lung adenocarcinoma, pancreatic cancer, metabolic disorders, and lung cancer. This protein has also been shown to have interactions with CIGALT1, CIGALT1C1, ST6GALNAC1, B3GNT6, and GCNT1 in pathways such as O-linked glycosylation of mucins, metabolism of proteins, and post-translational protein modification.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB26291
Species: Mu
Applications: IHC
AF1819
Species: Mu
Applications: ELISA, IHC, WB
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
NBP1-84297
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
MAB7665
Species: Hu
Applications: IHC, WB
NBP1-83164
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-02677
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF4386
Species: Mu
Applications: IHC, WB
MAB7940
Species: Hu
Applications: IHC, WB
8090-ZN
Species: Hu
Applications: EnzAct
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-86713
Species: Hu
Applications: IHC,  IHC-P
NBP1-86059
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24750
Species: Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB

Publications for Polypeptide GalNac Transferase 3/GALNT3 Protein (NBP1-81849PEP) (0)

There are no publications for Polypeptide GalNac Transferase 3/GALNT3 Protein (NBP1-81849PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Polypeptide GalNac Transferase 3/GALNT3 Protein (NBP1-81849PEP) (0)

There are no reviews for Polypeptide GalNac Transferase 3/GALNT3 Protein (NBP1-81849PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Polypeptide GalNac Transferase 3/GALNT3 Protein (NBP1-81849PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Polypeptide GalNac Transferase 3/GALNT3 Products

Blogs on Polypeptide GalNac Transferase 3/GALNT3

There are no specific blogs for Polypeptide GalNac Transferase 3/GALNT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Polypeptide GalNac Transferase 3/GALNT3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GALNT3