POLR3F Recombinant Protein Antigen

Images

 
There are currently no images for POLR3F Recombinant Protein Antigen (NBP2-56658PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

POLR3F Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLR3F.

Source: E. coli

Amino Acid Sequence: IKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQCFKFLQSKAETARESKQNPMIQR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POLR3F
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56658.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for POLR3F Recombinant Protein Antigen

  • DNA-directed RNA polymerase III 39 kDa polypeptide
  • DNA-directed RNA polymerase III subunit F
  • DNA-directed RNA polymerase III subunit RPC6
  • DNA-directed RNA polymerases III 39 kDa polypeptide
  • polymerase (RNA) III (DNA directed) polypeptide F (39 kDa)
  • polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa
  • RNA polymerase III 39 kDa subunit
  • RNA polymerase III C39 subunit
  • RNA polymerase III subunit C6
  • RPC39MGC13517
  • RPC6

Background

POLR3F is encoded by this gene is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80816
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-81714
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-53092
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00009533-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-84628
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP1-82655
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45900
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-55778
Species: Hu
Applications: ICC/IF
NBP1-80817
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84621
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-00482
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-47329
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-93617
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NB100-1805
Species: Hu, Mu, Ye
Applications: IHC,  IHC-P, IP, Single-Cell Western, WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90837
Species: Hu
Applications: IHC,  IHC-P, WB
NB600-241
Species: Hu, Mu, Pl, Rt
Applications: ChIP, ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IM, KD, Simple Western, WB
NBP3-48813
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87113
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for POLR3F Recombinant Protein Antigen (NBP2-56658PEP) (0)

There are no publications for POLR3F Recombinant Protein Antigen (NBP2-56658PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR3F Recombinant Protein Antigen (NBP2-56658PEP) (0)

There are no reviews for POLR3F Recombinant Protein Antigen (NBP2-56658PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for POLR3F Recombinant Protein Antigen (NBP2-56658PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POLR3F Products

Blogs on POLR3F

There are no specific blogs for POLR3F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our POLR3F Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR3F