We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

POLR2E Recombinant Protein Antigen

Images

 
There are currently no images for POLR2E Recombinant Protein Antigen (NBP2-49577PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

POLR2E Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLR2E.

Source: E. coli

Amino Acid Sequence: RTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POLR2E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49577.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for POLR2E Recombinant Protein Antigen

  • DNA directed RNA polymerase II 23 kda polypeptide
  • DNA-directed RNA polymerase II 23 kDa polypeptide
  • DNA-directed RNA polymerase II subunit E
  • DNA-directed RNA polymerases I, II, and III subunit RPABC1
  • hRPB25
  • hsRPB5
  • polymerase (RNA) II (DNA directed) polypeptide E (25kD)
  • polymerase (RNA) II (DNA directed) polypeptide E, 25kDa
  • RPABC1
  • RPB5 homolog
  • RPB5
  • XAP4RNA polymerases I, II, and III subunit ABC1

Background

POLR2E encodes the fifth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases and is present in two-fold molar excess over the other polymerase subunits. An interaction between this subunit and a hepatitis virus transactivating protein has been demonstrated, suggesting that interaction between transcriptional activators and the polymerase can occur through this subunit. A pseudogene is located on chromosome 11.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-598
Species: Hu, Mu, Pm(-), Ye
Applications: ChIP, CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IP, WB
NBP1-80816
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-53092
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP1-80818
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-79413
Species: Hu
Applications: WB
NBP2-93863
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-93617
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP3-15275
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-55166
Species: Hu
Applications: WB
NBP2-47329
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-92344
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP3-17971
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
NBP1-81714
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-34143
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, KD, WB
NBP3-46250
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP3-03329
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-16601
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB

Publications for POLR2E Recombinant Protein Antigen (NBP2-49577PEP) (0)

There are no publications for POLR2E Recombinant Protein Antigen (NBP2-49577PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR2E Recombinant Protein Antigen (NBP2-49577PEP) (0)

There are no reviews for POLR2E Recombinant Protein Antigen (NBP2-49577PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for POLR2E Recombinant Protein Antigen (NBP2-49577PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POLR2E Products

Research Areas for POLR2E Recombinant Protein Antigen (NBP2-49577PEP)

Find related products by research area.

Blogs on POLR2E

There are no specific blogs for POLR2E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our POLR2E Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR2E