POLR1D Recombinant Protein Antigen

Images

 
There are currently no images for POLR1D Protein (NBP1-82655PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

POLR1D Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLR1D.

Source: E.coli

Amino Acid Sequence: EAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POLR1D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82655.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for POLR1D Recombinant Protein Antigen

  • AC19
  • DNA-directed RNA polymerase I subunit D
  • DNA-directed RNA polymerases I and III subunit RPAC2
  • FLJ20616
  • hRPA19
  • MGC9850
  • POLR1C
  • polymerase (RNA) I polypeptide D, 16kDa
  • RPA16RNA polymerase I 16 kDa subunit
  • RPA9
  • RPAC2RNA polymerases I and III subunit AC2
  • RPC16
  • RPO1-3
  • TCS2

Background

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80817
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93617
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-86908
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-53092
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-84628
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89314
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-93863
Species: Mu, Rt
Applications: IHC, IHC-P
NBP1-86780
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-83204
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87113
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB300-268
Species: Bv, Ce, Hu, I, Mu, Pl
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00482
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32716
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-80816
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB200-598
Species: Hu, Mu, Pm(-), Ye
Applications: ChIP, CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IP, WB
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for POLR1D Protein (NBP1-82655PEP) (0)

There are no publications for POLR1D Protein (NBP1-82655PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR1D Protein (NBP1-82655PEP) (0)

There are no reviews for POLR1D Protein (NBP1-82655PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for POLR1D Protein (NBP1-82655PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POLR1D Products

Bioinformatics Tool for POLR1D Protein (NBP1-82655PEP)

Discover related pathways, diseases and genes to POLR1D Protein (NBP1-82655PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR1D Protein (NBP1-82655PEP)

Discover more about diseases related to POLR1D Protein (NBP1-82655PEP).
 

Pathways for POLR1D Protein (NBP1-82655PEP)

View related products by pathway.

Blogs on POLR1D

There are no specific blogs for POLR1D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our POLR1D Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR1D