PNMA2 Antibody - BSA Free

Western Blot: PNMA2 Antibody [NBP2-85508] - WB Suggested Anti-PNMA2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PNMA2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PNMA2 Antibody - BSA Free (NBP2-85508) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNMA2. Peptide sequence: ELKDQGPPPSFLELMKVIREEEEEEASFENESIEEPEERDGYGRWNHEGD The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PNMA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PNMA2 Antibody - BSA Free

• MA2KIAA0883
• MM2
• Onconeuronal antigen Ma2
• paraneoplastic antigen MA2,40 kDa neuronal protein
• Paraneoplastic neuronal antigen MM2
• retrotransposon gag domain containing 2
• RGAG2

Background

In patients with cancer, symptoms of limbic and brain-stem dysfunction may result from a para-neoplastic disorder. Two proteins, Ma1 and Ma2, were discovered by presence of autoantibodies against them. Antibodies to Ma1 and Ma2 proteins identify a paraneoplastic disorder that affects the limbic system, brain stem, and cerebellum. These autoantibodies were used to clone Ma2, which codes for a protein (Ma2) that was recognized by serum from the 10 patients, but not by serum from 344 control subjects. Ma2 was selectively expressed by normal brain tissue and by the testicular tumors of the patients. Ma2 shares homology with Ma1, a "brain-testis-cancer" gene related to other para-neoplastic syndromes and tumors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PNMA2