PMS2 Antibody (4D11)

Images

 
Immunocytochemistry/ Immunofluorescence: PMS2 Antibody (4D11) [H00005395-M05] - Analysis of monoclonal antibody to PMS2 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: PMS2 Antibody (4D11) [H00005395-M05] - Detection limit for recombinant GST tagged PMS2 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
4D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PMS2 Antibody (4D11) Summary

Immunogen
PMS2 (NP_000526 763 a.a. - 862 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ERAKLISLPTSKNWTFGPQDVDELIFMLSDSPGVMCRPSRVKQMFASRACRKSVMIGTALNTSEMKKLITHMGEMDHPWNCPHGRPTMRHIANLGVISQN
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PMS2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PMS2 Antibody (4D11)

  • DNA mismatch repair protein PMS2
  • EC 3.1
  • H_DJ0042M02.9
  • HNPCC4postmeiotic segregation increased (S. cerevisiae) 2
  • mismatch repair endonuclease PMS2
  • PMS1 protein homolog 2
  • PMS2 postmeiotic segregation increased 2 (S. cerevisiae)
  • PMSL2PMS2CL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56552
Species: Hu
Applications: WB
NB100-621
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-329
Species: Hu
Applications: WB, IHC, IP, PLA, RIA
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-58368
Species: Hu
Applications: ICC/IF
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55958
Species: Hu
Applications: ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-02377
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
MAB2476
Species: Hu
Applications: WB, IHC
H00005395-M05
Species: Hu
Applications: ELISA, ICC/IF

Publications for PMS2 Antibody (H00005395-M05) (0)

There are no publications for PMS2 Antibody (H00005395-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PMS2 Antibody (H00005395-M05) (0)

There are no reviews for PMS2 Antibody (H00005395-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PMS2 Antibody (H00005395-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PMS2 Products

Bioinformatics Tool for PMS2 Antibody (H00005395-M05)

Discover related pathways, diseases and genes to PMS2 Antibody (H00005395-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMS2 Antibody (H00005395-M05)

Discover more about diseases related to PMS2 Antibody (H00005395-M05).
 

Pathways for PMS2 Antibody (H00005395-M05)

View related products by pathway.

PTMs for PMS2 Antibody (H00005395-M05)

Learn more about PTMs related to PMS2 Antibody (H00005395-M05).
 

Research Areas for PMS2 Antibody (H00005395-M05)

Find related products by research area.

Blogs on PMS2

There are no specific blogs for PMS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMS2 Antibody (4D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol PMS2
Uniprot