PMP70 Antibody (2H6)

Images

 
Sandwich ELISA: PMP70 Antibody (2H6) [H00005825-M04] - Detection limit for recombinant GST tagged ABCD3 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PMP70 Antibody (2H6) Summary

Immunogen
ABCD3 (NP_002849.1, 351 a.a. - 449 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SELLEDYYQSGRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGKYERTMVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLAT
Marker
Proxisomal Membrane Marker
Specificity
ABCD3 - ATP-binding cassette, sub-family D (ALD), member 3 (2H6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ABCD3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PMP70 Antibody (2H6)

  • 70 kDa peroxisomal membrane protein
  • ABC43
  • ATP-binding cassette, sub-family D (ALD), member 3
  • peroxisomal membrane protein 1 (70kD, Zellweger syndrome)
  • Peroxisomal membrane protein-1 (70kD)
  • PMP70ATP-binding cassette sub-family D member 3
  • PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1))
  • ZWS2

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein likely plays an important role in peroxisome biogenesis. Mutations have been associated with some forms of Zellweger syndrome, a heterogeneous group of peroxisome assembly disorders. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46476
Species: Hu
Applications: WB, IHC
NBP1-33435
Species: Hu
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-83954
Species: Hu
Applications: IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
NBL1-15012
Species: Hu
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33556
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32925
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
H00008443-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP1-87185
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PMP70 Antibody (H00005825-M04) (0)

There are no publications for PMP70 Antibody (H00005825-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PMP70 Antibody (H00005825-M04) (0)

There are no reviews for PMP70 Antibody (H00005825-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PMP70 Antibody (H00005825-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PMP70 Products

Bioinformatics Tool for PMP70 Antibody (H00005825-M04)

Discover related pathways, diseases and genes to PMP70 Antibody (H00005825-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMP70 Antibody (H00005825-M04)

Discover more about diseases related to PMP70 Antibody (H00005825-M04).
 

Pathways for PMP70 Antibody (H00005825-M04)

View related products by pathway.

PTMs for PMP70 Antibody (H00005825-M04)

Learn more about PTMs related to PMP70 Antibody (H00005825-M04).
 

Research Areas for PMP70 Antibody (H00005825-M04)

Find related products by research area.

Blogs on PMP70

There are no specific blogs for PMP70, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMP70 Antibody (2H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCD3
Entrez
Uniprot