PMCA1 Antibody

Images

 
Western Blot: PMCA1 Antibody [NBP1-87261] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 10. Lane 2: Human Cerebral Cortex tissue.
Immunocytochemistry/ Immunofluorescence: PMCA1 Antibody [NBP1-87261] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleus & plasma membrane.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PMCA1 Antibody [NBP1-87261] - Staining in human cerebral cortex and kidney tissues using anti-ATP2B1 antibody. Corresponding ATP2B1 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: PMCA1 Antibody [NBP1-87261] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: PMCA1 Antibody [NBP1-87261] - Staining of human kidney shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PMCA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGI
Specificity
Specificity of human PMCA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP2B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
PMCA1 Knockout HeLa Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PMCA1 Antibody

  • ATPase, Ca++ transporting, plasma membrane 1
  • EC 3.6.3
  • EC 3.6.3.8
  • Plasma membrane calcium ATPase isoform 1
  • plasma membrane calcium ATPase
  • Plasma membrane calcium pump isoform 1
  • plasma membrane calcium pump
  • plasma membrane calcium-ATPase
  • PMCA1kb
  • PMCA1plasma membrane calcium-transporting ATPase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-3529
Species: Hu, Rt, Po
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB300-569
Species: Hu, Mu, Rt, Po, Am, Bv, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
NBP1-87259
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-67413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-50028
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P, IHC-FrFl
NBP2-56483
Species: Hu
Applications: ICC/IF
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
AF3320
Species: Hu
Applications: WB, IHC
H00001594-Q01
Species: Hu
NBP2-85926
Species: Hu
Applications: WB, IHC
NBP2-66778
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
H00000489-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-858
Species: Hu, Mu, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
NB300-622
Species: Hu, Mu, Rt, Am, Ca, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for PMCA1 Antibody (NBP1-87261) (0)

There are no publications for PMCA1 Antibody (NBP1-87261).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PMCA1 Antibody (NBP1-87261) (0)

There are no reviews for PMCA1 Antibody (NBP1-87261). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PMCA1 Antibody (NBP1-87261) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PMCA1 Products

Array NBP1-87261

Bioinformatics Tool for PMCA1 Antibody (NBP1-87261)

Discover related pathways, diseases and genes to PMCA1 Antibody (NBP1-87261). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMCA1 Antibody (NBP1-87261)

Discover more about diseases related to PMCA1 Antibody (NBP1-87261).
 

Pathways for PMCA1 Antibody (NBP1-87261)

View related products by pathway.

PTMs for PMCA1 Antibody (NBP1-87261)

Learn more about PTMs related to PMCA1 Antibody (NBP1-87261).
 

Research Areas for PMCA1 Antibody (NBP1-87261)

Find related products by research area.

Blogs on PMCA1

There are no specific blogs for PMCA1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMCA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP2B1
COVID-19 update