Home » SERCA3 ATPase » SERCA3 ATPase Antibodies » SERCA3 ATPase Antibody (2H3)

SERCA3 ATPase Antibody (2H3)

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: SERCA3 ATPase Antibody (2H3) [H00000489-M01] - ATP2A3 monoclonal antibody (M01), clone 2H3 Analysis of ATP2A3 expression in HL-60.
Western Blot: SERCA3 ATPase Antibody (2H3) [H00000489-M01] - ATP2A3 monoclonal antibody (M01), clone 2H3 Analysis of ATP2A3 expression in HL-60.
Immunohistochemistry-Paraffin: SERCA3 ATPase Antibody (2H3) [H00000489-M01] - Analysis of monoclonal antibody to ATP2A3 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.
ELISA: SERCA3 ATPase Antibody (2H3) [H00000489-M01] - Detection limit for recombinant GST tagged ATP2A3 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SERCA3 ATPase Antibody (2H3) Summary

Immunogen
ATP2A3 (AAH35729, 501 a.a. - 620 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR
Specificity
ATP2A3 - ATPase, Ca++ transporting, ubiquitous
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ATP2A3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publications using H00000489-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SERCA3 ATPase Antibody (2H3)

  • adenosine triphosphatase, calcium
  • ATPase, Ca(2+)-transporting, ubiquitous
  • ATPase, Ca++ transporting, ubiquitous
  • Calcium pump 3
  • EC 3.6.3
  • EC 3.6.3.8
  • sarco/endoplasmic reticulum Ca2+ ATPase
  • sarco/endoplasmic reticulum Ca2+ -ATPase
  • sarcoplasmic/endoplasmic reticulum calcium ATPase 3
  • SERCA3calcium-translocating P-type ATPase
  • SR Ca(2+)-ATPase 3

Background

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SERCA2 ATPase
Antibody (2A7-A1)
NB300-581
Immunocytochemistry/Immunofluorescence: SERCA2 ATPase Antibody (2A7-A1) [NB300-581] - HeLa cells. Primary antibody at 1:100, secondary antibody: goat-anti mouse IgG AlexaFluor 568 at 1:100. Image from verified customer review.
Immunohistochemistry-Paraffin: SERCA2 ATPase Antibody (2A7-A1) [NB300-581] - Both normal and cancer biopsies of deparaffinized Human skeletal muscle tissues.
Immunocytochemistry/Immunofluorescence: SERCA2 ATPase Antibody (2A7-A1) [NB300-581] - SERCA2 ATPase staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing SERCA2 ATPase at a dilution of 1:100-1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
SERCA1 ATPase
Antibody (VE121G9)
NB300-622
Western Blot: SERCA1 ATPase Antibody (VE121G9) [NB300-622] - Analysis of 25 ug of human skeletal muscle (lane 1), rat skeletal muscle (lane 2) and mouse skeletal muscle (lane 3).
Immunocytochemistry/Immunofluorescence: SERCA1 ATPase Antibody (VE121G9) [NB300-622] - SERCA1 ATPase staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing SERCA1 ATPase at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: SERCA1 ATPase Antibody (VE121G9) [NB300-622] - Both normal and cancer biopsies of deparaffinized Human heart tissue tissues.
Species: Hu, Mu, Rt, Am, Ca, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Insulin E2E3, human pancreas (FFPE), HIER pH 9 antigen retrieval. Image from verified customer review.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(5 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Phospholamban
Antibody
NBP1-85543
Western Blot: Phospholamban Antibody [NBP1-85543] - Analysis in human heart tissue.
Immunohistochemistry-Paraffin: Phospholamban Antibody [NBP1-85543] - Staining of human skin shows low expression as expected.
Immunohistochemistry-Paraffin: Phospholamban Antibody [NBP1-85543] - Staining of human heart muscle shows high expression.
Species: Hu
Applications: WB, IHC, IHC-P
PMCA2 Antibody
NB120-3529
Immunohistochemistry-Paraffin: PMCA2 Antibody [NB120-3529] - Immunohistochemistry was performed on normal biopsies of deparaffinized Human brain tissue. To expose target proteins, heat induced antigen retrieval was performed using 10mM sodium citrate (pH6.0) buffer, microwaved for 8-15 minutes. Following antigen retrieval tissues were blocked in 3% BSA-PBS for 30 minutes at room temperature. Tissues were then probed at a dilution of 1:200 with a rabbit polyclonal antibody recognizing PMCA2 ATPase or without primary antibody (negative control) overnight at 4C in a humidified chamber. Tissues were washed extensively with PBST and endogenous peroxidase activity was quenched with a peroxidase suppressor. Tissues were counterstained with hematoxylin and prepped for mounting.
Immunohistochemistry-Paraffin: PMCA2 Antibody [NB120-3529] - Cancer biopsies of deparaffinized Human cervical carcinoma tissue.
Species: Hu, Rt, Po
Applications: WB, ELISA, IHC-Fr, IHC-P
PMCA4 Antibody
(JA9)
NB300-569
Immunocytochemistry/Immunofluorescence: PMCA4 Antibody (JA9) [NB300-569] - Immunolocalization of (A) PMCA4 (green), (B) CaSRO (red), and (C) Merged image.
Immunohistochemistry-Paraffin: PMCA4 Antibody (JA9) [NB300-569] - Normal biopsies of deparaffinized Human brain tissue.
Immunocytochemistry/Immunofluorescence: PMCA4 Antibody (JA9) [NB300-569] - Figure 1 illustrates immunolocalization of PMCA4 and CaSRO in human corneal epithelium. (A) Immunolocalization of PMCA4 (green) using NB300-569 on cell membranes of all cells in each layer of hCE. (B) Immunolocalization of CaSRO (red)on cell membranes of hCE. (C) Merged image. Figure 2 illustrates immunolocalization of PMCA4 and CaSRO in bovine corneal epithelium (bCE). (A) Immunolocalization of PMCA4 (green) on cell membranes of all cells in each layer of bCE. (B) Immunolocalization of CaSRO (red) on cell membranes of bCE mostly in wing- and squamous cell layers. (C) Merged image.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Po, Am, Bv, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Thyroglobulin
Antibody (904802) [Un ...
MAB8306
Western blot shows lysates of human thyroid tissue. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human Thyroglobulin Monoclonal Antibody (Catalog # MAB8306) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for Thyroglobulin at approximately 300 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Thyroglobulin was detected in immersion fixed paraffin-embedded sections of human thyroid cancer tissue using Mouse Anti-Human Thyroglobulin Monoclonal Antibody (Catalog # MAB8306) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific staining was localized to epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
Species: Hu
Applications: WB, IHC
HOXA10
Overexpression Lysate
NBL1-11664
Western Blot: HOXA10 Overexpression Lysate (Adult Normal) [NBL1-11664] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for HOXA10.
Species: Hu
Pancreatic Lipase
Antibody
NBP2-38958
Immunohistochemistry-Paraffin: Pancreatic Lipase Antibody [NBP2-38958] - Staining of human pancreas shows high expression.
Immunohistochemistry-Paraffin: Pancreatic Lipase Antibody [NBP2-38958] - Staining of human pancreas shows high expression.
Immunohistochemistry-Paraffin: Pancreatic Lipase Antibody [NBP2-38958] - Staining of human tonsil shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
Placental
Lactogen/CSH1 Antibod ...
NBP2-46376
Western Blot: Placental Lactogen/CSH1 Antibody (2G4) [NBP2-46376] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY CSH1.
Immunohistochemistry: Placental Lactogen/CSH1 Antibody (2G4) [NBP2-46376] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: Placental Lactogen/CSH1 Antibody (2G4) [NBP2-46376] - Analysis of Human breast tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu
Applications: WB, IHC
PMCA1 Antibody
(5F10)
NB300-578
Western Blot: PMCA1 Antibody (5F10) [NB300-578] - Analysis of 25 ug of U251 (lane 1), human brain (lane 2) and C2C12 (lane 3).
Immunocytochemistry/Immunofluorescence: PMCA1 Antibody (5F10) [NB300-578] - Analysis of PMCA ATPase using Anti-PMCA ATPase Monoclonal Antibody (5F10) shows staining in U251 Cells. PMCA ATPase staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing PMCA ATPase at a dilution of 1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: PMCA1 Antibody (5F10) [NB300-578] - Both normal and cancer biopsies of deparaffinized Human colon carcinoma tissues.
(7 Publications)
Species: Hu, Mu, Rt, Po, Am, Ca, Ch, Fe, Ha, Pm, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
GRP78/HSPA5
Antibody
NBP1-06274
Western Blot: GRP78/HSPA5 Antibody [NBP1-06274] - Total protein from human HeLa and A431 cells, mouse 3T3 cells and rat PC12 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-GPR78 in blocking buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: GRP78/HSPA5 Antibody [NBP1-06274] - NIH-3T3 cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-GRP78/HSPA5 at 2 ug/mL overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: GRP78/HSPA5 Antibody [NBP1-06274] - An intracellular stain was performed on NIH3T3 cells with GRP78/HSPA5 Antibody NBP1-06274AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
(1 Review)
(16 Publications)
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
gamma-Synuclein
Antibody (JM90-32)
NBP2-66861
Western Blot: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Analysis of gamma Synuclein on rat kidney tissue lysate using anti-gamma Synuclein antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Staining gamma Synuclein in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Analysis of paraffin-embedded rat brain tissue using anti-gamma Synuclein antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Secretin R Antibody
AF6387
Western blot shows lysates of human brain (cerebellum) tissue. PVDF Membrane was probed with 1 µg/mL of Human Secretin R Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6387) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Secretin R delta 3/4 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
IP3R1 Antibody
NBP1-21398
Western Blot: IP3R1 Antibody [NBP1-21398] - Whole cell lysate from HeLa cells. Affinity purified rabbit anti-IP3R1 antibody. IP3R1 was also immunoprecipitated by rabbit anti-IP3R1 antibody NBP1-21397.
Immunohistochemistry: IP3R1 Antibody [NBP1-21398] - Sample: FFPE section of mouse cerebellum. Antibody: Affinity purified rabbit anti- IP3R1 used at a dilution of 1:200 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
Immunohistochemistry: IP3R1 Antibody [NBP1-21398] - Sample: FFPE section of mouse cerebellum. Antibody: Affinity purified rabbit anti- IP3R1 used at a dilution of 1:100 (2ug/ml). Detection: Red-fluorescent Goat anti-Rabbit IgG-heavy and light chain cross-adsorbed Antibody DyLight 594 Conjugated (A120-601D4
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
TCF7L2 Antibody
(3A4)
H00006934-M06
Western Blot: TCF7L2 Antibody (3A4) [H00006934-M06] - Analysis of TCF7L2 expression in K-562 (Cat # L009V1).
Immunocytochemistry/Immunofluorescence: TCF7L2 Antibody (3A4) [H00006934-M06] - Analysis of monoclonal antibody to TCF7L2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: TCF7L2 Antibody (3A4) [H00006934-M06] - Analysis of monoclonal antibody to TCF7L2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
SP1 Antibody
NB600-233
Western Blot: SP1 Antibody [NB600-233] - Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells.
Immunohistochemistry-Paraffin: SP1 Antibody [NB600-233] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-SP1 used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
Western Blot: SP1 Antibody [NB600-233] - Samples: Whole cell lysate (50 ug) from HeLa, 293T, and mouse Renca cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SP1 antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
(4 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Ryanodine Receptor
2 Antibody
NBP1-90091
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Analysis in human heart muscle and liver tissues. Corresponding RYR2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P

Publications for SERCA3 ATPase Antibody (H00000489-M01)(3)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SERCA3 ATPase Antibody (H00000489-M01) (0)

There are no reviews for SERCA3 ATPase Antibody (H00000489-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SERCA3 ATPase Antibody (H00000489-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SERCA3 ATPase Antibody (H00000489-M01)

Discover related pathways, diseases and genes to SERCA3 ATPase Antibody (H00000489-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SERCA3 ATPase Antibody (H00000489-M01)

Discover more about diseases related to SERCA3 ATPase Antibody (H00000489-M01).
 

Pathways for SERCA3 ATPase Antibody (H00000489-M01)

View related products by pathway.

PTMs for SERCA3 ATPase Antibody (H00000489-M01)

Learn more about PTMs related to SERCA3 ATPase Antibody (H00000489-M01).

Blogs on SERCA3 ATPase.

Check out the latest blog posts on SERCA3 ATPase.
Mending a Broken Heart: New SERCA2 Gene Therapy Fights Heart Disease
While many of the proteins on our antibody database are studied in relation to their expression in diseases; others become therapies in their own right. This is the case with SERCA2 (Sarcoplasmic reticulum Calcium-ATPase 2 pump), which recently hit th...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SERCA3 ATPase Antibody (2H3) and receive a gift card or discount.


Bioinformatics

Gene Symbol ATP2A3
Entrez
OMIM
Uniprot