PLSCR2 Antibody


Western Blot: PLSCR2 Antibody [NBP3-09499] - Western blot analysis of PLSCR2 in Fetal Heart as a positive control. Antibody dilution at 1.0 ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB
0.5 mg/ml

Order Details

PLSCR2 Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PLSCR2 (NP_065092). Peptide sequence PVGYVTQTWHPCLTKFTIKNQKREDVLKISGPCIVCSCIAGVDFEITSLD
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
0.5 mg/ml
Affinity purified

Alternate Names for PLSCR2 Antibody

  • phospholipid scramblase 2


PLSCR2 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in theplasma membrane. May play a central role in the initiation of fibrin clot forma


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: ICC/IF, IP, WB

Publications for PLSCR2 Antibody (NBP3-09499) (0)

There are no publications for PLSCR2 Antibody (NBP3-09499).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLSCR2 Antibody (NBP3-09499) (0)

There are no reviews for PLSCR2 Antibody (NBP3-09499). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLSCR2 Antibody (NBP3-09499) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PLSCR2 Products

Diseases for PLSCR2 Antibody (NBP3-09499)

Discover more about diseases related to PLSCR2 Antibody (NBP3-09499).

Pathways for PLSCR2 Antibody (NBP3-09499)

View related products by pathway.

PTMs for PLSCR2 Antibody (NBP3-09499)

Learn more about PTMs related to PLSCR2 Antibody (NBP3-09499).

Blogs on PLSCR2

There are no specific blogs for PLSCR2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PLSCR2 Antibody and receive a gift card or discount.


Gene Symbol PLSCR2