PLK3 Antibody


Western Blot: PLK3 Antibody [NBP2-32530] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Orthogonal Strategies: Immunohistochemistry-Paraffin: PLK3 Antibody [NBP2-32530] - Staining in human gallbladder and duodenum tissues using anti-PLK3 antibody. Corresponding PLK3 RNA-seq data are presented for more
Immunohistochemistry-Paraffin: PLK3 Antibody [NBP2-32530] - Staining of human duodenum shows low expression as expected.
Immunohistochemistry-Paraffin: PLK3 Antibody [NBP2-32530] - Staining of human gallbladder shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

PLK3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: DHTKLILSGWEPLLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLL
Specificity of human PLK3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLK3 Protein (NBP2-32530PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PLK3 Antibody

  • CNK
  • CNKpolo-like kinase 3 (Drosophila)
  • cytokine-inducible kinase
  • Cytokine-inducible serine/threonine-protein kinase
  • EC 2.7.11
  • FNK
  • PLK3
  • polo-like kinase 3PLK-3
  • PRK
  • PRKFGF-inducible kinase
  • Proliferation-related kinase
  • serine/threonine-protein kinase PLK3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Fe, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
Species: Hu, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Flow, ICC/IF, PEP-ELISA
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PLK3 Antibody (NBP2-32530) (0)

There are no publications for PLK3 Antibody (NBP2-32530).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLK3 Antibody (NBP2-32530) (0)

There are no reviews for PLK3 Antibody (NBP2-32530). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLK3 Antibody (NBP2-32530) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PLK3 Antibody (NBP2-32530)

Discover related pathways, diseases and genes to PLK3 Antibody (NBP2-32530). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLK3 Antibody (NBP2-32530)

Discover more about diseases related to PLK3 Antibody (NBP2-32530).

Pathways for PLK3 Antibody (NBP2-32530)

View related products by pathway.

PTMs for PLK3 Antibody (NBP2-32530)

Learn more about PTMs related to PLK3 Antibody (NBP2-32530).

Research Areas for PLK3 Antibody (NBP2-32530)

Find related products by research area.

Blogs on PLK3

There are no specific blogs for PLK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PLK3 Antibody and receive a gift card or discount.


Gene Symbol PLK3