PLK3 Antibody

Immunohistochemistry-Paraffin: PLK3 Antibody [NBP2-32530] - Analysis in human gallbladder and skeletal muscle tissues using NBP2-32530 antibody. Corresponding PLK3 RNA-seq data are presented for the same tissues.

Western Blot: PLK3 Antibody [NBP2-32530] - Analysis in human cell line SK-MEL-30.

Immunohistochemistry-Paraffin: PLK3 Antibody [NBP2-32530] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: PLK3 Antibody [NBP2-32530] - Staining of human endometrium shows weak to moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: PLK3 Antibody [NBP2-32530] - Staining of human gallbladder shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: PLK3 Antibody [NBP2-32530] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: PLK3 Antibody [NBP2-32530] - Staining of human testis shows strong nuclear positivity in Leydig cells.

Product Discontinued

PLK3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DHTKLILSGWEPLLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLL
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLK3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific publication (PMID: 32575753).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PLK3 Antibody

• CNK
• CNKpolo-like kinase 3 (Drosophila)
• cytokine-inducible kinase
• Cytokine-inducible serine/threonine-protein kinase
• EC 2.7.11
• FNK
• FNKEC 2.7.11.21
• PLK3
• polo-like kinase 3PLK-3
• PRK
• PRKFGF-inducible kinase
• Proliferation-related kinase
• serine/threonine-protein kinase PLK3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PLK3 Antibody (NBP2-32530)(2)

Publications using NBP2-32530

• Guerber L, Vuidel A, Liao Y et al. UBAP2L-dependent coupling of PLK1 localization and stability during mitosis EMBO reports 2023-06-05 [PMID: 37039032] (WB, Human)
• Aquino Perez C, Palek M, Stolarova L et al. Phosphorylation of PLK3 Is Controlled by Protein Phosphatase 6 Cells 2020-06-20 [PMID: 32575753] (ICC/IF, WB, Human)

Bioinformatics

• Gene Symbol: PLK3