PLD6 Antibody

Images

 
Immunohistochemistry-Paraffin: PLD6 Antibody [NBP2-13771] Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLD6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QDPGYMHHKFAIVDKRVLITGSLNWTTQAIQNNRENVLITEDDEYVRLFL EEFERIWEQFNPTKYTFFPPKKSHGSCAPPVSRAGGRLLSWHRTCGTSSE SQT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLD6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLD6 Protein (NBP2-13771PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLD6 Antibody

  • Choline phosphatase 6
  • EC 3.1.4.-
  • Mitochondrial phospholipase
  • MitoPLD
  • Phosphatidylcholine-hydrolyzing phospholipase D6
  • phospholipase D family, member 6
  • Phospholipase D6
  • PLD 6
  • Protein zucchini homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5018
Species: Hu
Applications: WB, IP
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88921
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-04299
Species: Hu
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88923
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF6548
Species: Hu, Mu
Applications: IHC
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready

Publications for PLD6 Antibody (NBP2-13771) (0)

There are no publications for PLD6 Antibody (NBP2-13771).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLD6 Antibody (NBP2-13771) (0)

There are no reviews for PLD6 Antibody (NBP2-13771). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PLD6 Antibody (NBP2-13771) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLD6 Products

PLD6 NBP2-13771

Bioinformatics Tool for PLD6 Antibody (NBP2-13771)

Discover related pathways, diseases and genes to PLD6 Antibody (NBP2-13771). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLD6 Antibody (NBP2-13771)

Discover more about diseases related to PLD6 Antibody (NBP2-13771).
 

Pathways for PLD6 Antibody (NBP2-13771)

View related products by pathway.

PTMs for PLD6 Antibody (NBP2-13771)

Learn more about PTMs related to PLD6 Antibody (NBP2-13771).
 

Research Areas for PLD6 Antibody (NBP2-13771)

Find related products by research area.

Blogs on PLD6

There are no specific blogs for PLD6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLD6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLD6