PLCXD1 Antibody

Images

 
Western Blot: PLCXD1 Antibody [NBP1-83753] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: PLCXD1 Antibody [NBP1-83753] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PLCXD1 Antibody [NBP1-83753] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLCXD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLNKALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEWL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLCXD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PLCXD1 Protein (NBP1-83753PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLCXD1 Antibody

  • FLJ11323
  • phosphatidylinositol-specific phospholipase C, X domain containing 1
  • PI-PLC X domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6117
Species: Hu
Applications: WB, IHC
NBP2-32046
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6130
Species: Mu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP1-85808
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008653-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-81739
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF1384
Species: Hu
Applications: WB, IHC, ICC
NBP2-14066
Species: Hu
Applications: IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
AF5735
Species: Hu
Applications: WB
NBP1-85219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PLCXD1 Antibody (NBP1-83753) (0)

There are no publications for PLCXD1 Antibody (NBP1-83753).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLCXD1 Antibody (NBP1-83753) (0)

There are no reviews for PLCXD1 Antibody (NBP1-83753). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PLCXD1 Antibody (NBP1-83753) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLCXD1 Products

Bioinformatics Tool for PLCXD1 Antibody (NBP1-83753)

Discover related pathways, diseases and genes to PLCXD1 Antibody (NBP1-83753). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLCXD1 Antibody (NBP1-83753)

Discover more about diseases related to PLCXD1 Antibody (NBP1-83753).
 

Pathways for PLCXD1 Antibody (NBP1-83753)

View related products by pathway.

Blogs on PLCXD1

There are no specific blogs for PLCXD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLCXD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCXD1