Home » PLCXD1 » PLCXD1 Antibodies » PLCXD1 Antibody

PLCXD1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PLCXD1 Antibody [NBP1-83753] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413089)
Western Blot: PLCXD1 Antibody [NBP1-83753] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: PLCXD1 Antibody [NBP1-83753] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PLCXD1 Antibody [NBP1-83753] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PLCXD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLNKALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEWL
Specificity
Specificity of human PLCXD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLCXD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PLCXD1 Protein (NBP1-83753PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLCXD1 Antibody

  • FLJ11323
  • phosphatidylinositol-specific phospholipase C, X domain containing 1
  • PI-PLC X domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RARRES1 Antibody
[Unconjugated]
AF4255
Western blot shows lysates of human heart tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human RARRES1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4255) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for RARRES1 at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(1 Review)
(3 Publications)
Species: Hu
Applications: WB
VAMP-7 Antibody
(549115)
MAB6117
Western blot shows lysates of A172 human glioblastoma cell line and K562 human chronic myelogenous leukemia cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human VAMP‑7 Monoclonal Antibody (Catalog # MAB6117) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for VAMP‑7 at approximately 25 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB, IHC
TMEM47
Overexpression Lysate
NBL1-17083
Western Blot: TMEM47 Overexpression Lysate (Adult Normal) [NBL1-17083] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for TMEM47.
Species: Hu
Plastin L Antibody
NBP1-88057
Western Blot: Plastin L Antibody [NBP1-88057] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-434
Immunocytochemistry/Immunofluorescence: Plastin L Antibody [NBP1-88057] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol and actin filaments.
Immunohistochemistry-Paraffin: Plastin L Antibody [NBP1-88057] - Staining in human spleen and skeletal muscle tissues using anti-LCP1 antibody. Corresponding LCP1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
GM-CSF R alpha
Antibody (698423) [Un ...
MAB6130
GM‑CSF R alpha was detected in immersion fixed J774A.1 mouse reticulum cell sarcoma macrophage cell line using Rat Anti-Mouse GM‑CSF R alpha Mono­clonal Antibody (Catalog # MAB6130) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red, upper panel; Catalog # NL013) and counterstained with DAPI (blue, lower panel). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
J774A.1 mouse reticulum cell sarcoma macrophage cell line was stained with Rat Anti-Mouse GM‑CSF R alpha Monoclonal Antibody (Catalog # MAB6130, filled histo­gram) or isotype control antibody (Catalog # MAB006, open histo­gram), followed by Allophy­cocyanin-conjugated Anti-Rat IgG Secondary Antibody (Catalog # F0113).
Recombinant Mouse GM‑CSF (Catalog # 415-ML) stimulates proliferation in the DA3 mouse myeloma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Mouse GM‑CSF (0.1 ng/mL) is neutralized (green line) by increasing concen­trations of Rat Anti-Mouse GM‑CSF R alpha Monoclonal Anti­body (Catalog # MAB6130). The ND50 is typically0.02-0.12 µg/mL.
(2 Publications)
Species: Mu
Applications: Flow, CyTOF-ready, ICC, Neut
EIF1AY Antibody
NBP1-85808
Western Blot: EIF1AY Antibody [NBP1-85808] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).
Immunocytochemistry/Immunofluorescence: EIF1AY Antibody [NBP1-85808] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: EIF1AY Antibody [NBP1-85808] - Staining of human prostate shows strong nuclear and cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
JTB Antibody
NBP1-81746
Western Blot: JTB Antibody [NBP1-81746] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: JTB Antibody [NBP1-81746] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: JTB Antibody [NBP1-81746] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
DDX3Y Antibody
NBP1-32780
Western Blot: DDX3Y Antibody [NBP1-32780] - A. 30 ug Jurkat B. 30 ug Raji C. 30 ug NCI-H929 7.5 % SDS-PAGE DDX3 antibody dilution: 1:10000
Immunocytochemistry/Immunofluorescence: DDX3Y Antibody [NBP1-32780] - Analysis of paraformaldehyde-fixed HeLa, using DDX3Y antibody at 1:200 dilution.
Western Blot: DDX3Y Antibody [NBP1-32780] - Sample (50 ug of whole cell lysate) A: Mouse brain 7. 5% SDS PAGE; antibody diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
ZNF22 Antibody
NBP1-81739
Western Blot: ZNF22 Antibody [NBP1-81739] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Tonsil
Immunocytochemistry/Immunofluorescence: ZNF22 Antibody [NBP1-81739] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus. Antibody staining shown in green.
Immunohistochemistry-Paraffin: ZNF22 Antibody [NBP1-81739] - Staining of human placenta shows nuclear positivity in trophoblastic cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Lipoprotein
Lipase/LPL Antibody [ ...
AF7197
Western blot shows lysates of SH‑SY5Y human neuroblastoma cell line and NMuMG mouse mammary gland epithelial cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Lipoprotein Lipase/LPL Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7197) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Lipoprotein Lipase/LPL at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Lipoprotein Lipase/LPL was detected in immersion fixed SH‑SY5Y human neuroblastoma cell line using Goat Anti-Human Lipoprotein Lipase/LPL Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7197) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips. This application has not been tested in mouse samples.
Lipoprotein Lipase/LPL was detected in immersion fixed paraffin-embedded sections of human heart using Goat Anti-Human/Mouse Lipoprotein Lipase/LPL Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7197) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cardiomyocytes. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, ICC
sFRP-1
[Unconjugated]
5396-SF
sFRP-1 [Unconjugated]
(9 Publications)
Species: Hu
OA1 Antibody
NBP2-14066
Immunohistochemistry-Paraffin: OA1 Antibody [NBP2-14066] - Staining of human skin shows moderate to strong cytoplasmic positivity in melanocytes.
Immunohistochemistry-Paraffin: OA1 Antibody [NBP2-14066] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: OA1 Antibody [NBP2-14066] - Staining in human skin and skeletal muscle tissues. Corresponding GPR143 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
PXR/NR1I2 Antibody
(1D12G1)
NBP2-61816
Western Blot: PXR/NR1I2 Antibody (1D12G1) [NBP2-61816] - Analysis using NR1I2 mAb against human NR1I2 (AA: 1-142) recombinant protein. (Expected MW is 42.2 kDa)
Immunocytochemistry/Immunofluorescence: PXR/NR1I2 Antibody (1D12G1) [NBP2-61816] - Analysis of Hela cells using NR1I2 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin. Secondary antibody from Fisher (Cat#: 35503)
Western Blot: PXR/NR1I2 Antibody (1D12G1) [NBP2-61816] - Analysis using NR1I2 mAb against HEK293 (1) and NR1I2 (AA: 1-142)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
SPRY3 Antibody
[Unconjugated]
AF5735
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line and MCF‑7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Human SPRY3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5735) followed by HRP-conjugated Anti‑Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for SPRY3 at approximately 42 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
DHRSX Antibody
NBP1-85219
Western Blot: DHRSX Antibody [NBP1-85219] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: DHRSX Antibody [NBP1-85219] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & actin filaments.
Immunohistochemistry-Paraffin: DHRSX Antibody [NBP1-85219] - Staining in human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Chordin-like
1/CHRDL1 [Unconjugate
1808-NR/CF
Chordin-like 1/CHRDL1 [Unconjugated]
(5 Publications)
Species: Hu

Publications for PLCXD1 Antibody (NBP1-83753) (0)

There are no publications for PLCXD1 Antibody (NBP1-83753).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLCXD1 Antibody (NBP1-83753) (0)

There are no reviews for PLCXD1 Antibody (NBP1-83753). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PLCXD1 Antibody (NBP1-83753) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLCXD1 Products

Bioinformatics Tool for PLCXD1 Antibody (NBP1-83753)

Discover related pathways, diseases and genes to PLCXD1 Antibody (NBP1-83753). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLCXD1 Antibody (NBP1-83753)

Discover more about diseases related to PLCXD1 Antibody (NBP1-83753).
 

Pathways for PLCXD1 Antibody (NBP1-83753)

View related products by pathway.

Blogs on PLCXD1

There are no specific blogs for PLCXD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLCXD1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PLCXD1