DHRSX Antibody - BSA Free

Western Blot: DHRSX Antibody [NBP1-85219] - Analysis in human cell line SH-SY5Y.

Immunocytochemistry/Immunofluorescence: DHRSX Antibody [NBP1-85219] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & actin filaments.

Immunohistochemistry-Paraffin: DHRSX Antibody [NBP1-85219] - Staining of human Pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: DHRSX Antibody [NBP1-85219] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: DHRSX Antibody [NBP1-85219] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: DHRSX Antibody [NBP1-85219] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: DHRSX Antibody [NBP1-85219] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: DHRSX Antibody [NBP1-85219] - Staining of human Cerebral cortex shows moderate cytoplasmic positivity in neuropil.

Immunohistochemistry-Paraffin: DHRSX Antibody [NBP1-85219] - Staining of human Duodenum shows weak cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: DHRSX Antibody [NBP1-85219] - Staining of human Kidney shows moderate cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DHRSX Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DHRSX Antibody - BSA Free (NBP1-85219) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DHRSX
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 1:100 - 1:250
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DHRSX Protein (NBP1-85219PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DHRSX Antibody - BSA Free

• CXorf11
• dehydrogenase/reductase (SDR family) X chromosome
• dehydrogenase/reductase (SDR family) X-linked
• DHRS5Xmember 1
• EC 1.1
• SDR46C1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DHRSX