PLCD4 Antibody

Images

 
Immunohistochemistry-Paraffin: PLCD4 Antibody [NBP2-38392] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: PLCD4 Antibody [NBP2-38392] - Staining of human heart muscle shows low expression as expected.
Immunohistochemistry-Paraffin: PLCD4 Antibody [NBP2-38392] - Staining in human skeletal muscle and heart muscle tissues using anti-PLCD4 antibody. Corresponding PLCD4 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLCD4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPSFSISDVETIRNGHDSELL
Specificity
Specificity of human PLCD4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLCD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLCD4 Protein (NBP2-38392PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLCD4 Antibody

  • EC 3.1.4.11
  • hPLCD4
  • MGC12837
  • Phosphoinositide phospholipase C-delta-4
  • phospholipase C, delta 4
  • Phospholipase C-delta-4
  • PLC delta4
  • PLC-delta-4,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2364
Species: Hu
Applications: WB, IHC
NBP2-19810
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF5315
Species: Hu, Mu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
H00085329-T01
Species: Hu
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-58719
Species: Hu
Applications: WB, ICC/IF
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-36777
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-38392
Species: Hu
Applications: IHC, IHC-P

Publications for PLCD4 Antibody (NBP2-38392) (0)

There are no publications for PLCD4 Antibody (NBP2-38392).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLCD4 Antibody (NBP2-38392) (0)

There are no reviews for PLCD4 Antibody (NBP2-38392). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PLCD4 Antibody (NBP2-38392) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PLCD4 Antibody (NBP2-38392)

Discover related pathways, diseases and genes to PLCD4 Antibody (NBP2-38392). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLCD4 Antibody (NBP2-38392)

Discover more about diseases related to PLCD4 Antibody (NBP2-38392).
 

Pathways for PLCD4 Antibody (NBP2-38392)

View related products by pathway.

Research Areas for PLCD4 Antibody (NBP2-38392)

Find related products by research area.

Blogs on PLCD4

There are no specific blogs for PLCD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLCD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCD4
Uniprot