PLC-gamma 1 Antibody (2A2)

Images

 
Western Blot: PLC-gamma 1 Antibody (2A2) [H00005335-M01] - PLCG1 monoclonal antibody (M01), clone 2A2 Analysis of PLCG1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: PLC-gamma 1 Antibody (2A2) [H00005335-M01] - Analysis of monoclonal antibody to PLCG1 on HeLa cell. Antibody concentration 40 ug/ml.
Proximity Ligation Assay: PLC-gamma 1 Antibody (2A2) [H00005335-M01] - Analysis of protein-protein interactions between PTK2 and PLCG1. HeLa cells were stained with anti-PTK2 rabbit purified polyclonal 1:1200 and ...read more
Proximity Ligation Assay: PLC-gamma 1 Antibody (2A2) [H00005335-M01] - Analysis of protein-protein interactions between HCK and PLCG1. Huh7 cells were stained with anti-HCK rabbit purified polyclonal 1:1200 and ...read more
Proximity Ligation Assay: PLC-gamma 1 Antibody (2A2) [H00005335-M01] - Analysis of protein-protein interactions between PDGFRB and PLCG1. Mahlavu cells were stained with anti-PDGFRB rabbit purified polyclonal 1:600 and ...read more
Sandwich ELISA: PLC-gamma 1 Antibody (2A2) [H00005335-M01] - Detection limit for recombinant GST tagged PLCG1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, PLA, S-ELISA
Clone
2A2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PLC-gamma 1 Antibody (2A2) Summary

Immunogen
PLCG1 (NP_002651, 1192 a.a. ~ 1291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
Localization
Cytoplasmic
Specificity
PLCG1 - phospholipase C, gamma 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PLCG1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Proximity Ligation Assay
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publication using H00005335-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLC-gamma 1 Antibody (2A2)

  • EC 3.1.4.11
  • gamma 1 (formerly subtype 148)
  • monophosphatidylinositol phosphodiesterase
  • NCKAP3,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1
  • phosphatidylinositol phospholipase C
  • phosphoinositidase C
  • phosphoinositide phospholipase C
  • Phosphoinositide phospholipase C-gamma-1
  • phospholipase C, gamma 1
  • phospholipase C-148
  • Phospholipase C-gamma-1
  • Phospholipase C-II
  • PLC11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1
  • PLC148
  • PLC-148
  • PLCG1
  • PLCgamma 1
  • PLC-gamma 1
  • PLC-gamma-1
  • PLC-II1-phosphatidyl-D-myo-inositol-4,5-bisphosphate
  • PPLCA
  • triphosphoinositide phosphodiesterase

Background

The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4466
Species: Hu, Mu
Applications: WB
NBP1-84796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF5128
Species: Hu, Mu, Rt
Applications: WB
AF2364
Species: Hu
Applications: IHC, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
236-EG
Species: Hu
Applications: BA
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP2-14868
Species: Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005335-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA, S-ELISA

Publications for PLC-gamma 1 Antibody (H00005335-M01)(1)

Reviews for PLC-gamma 1 Antibody (H00005335-M01) (0)

There are no reviews for PLC-gamma 1 Antibody (H00005335-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PLC-gamma 1 Antibody (H00005335-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLC-gamma 1 Products

Bioinformatics Tool for PLC-gamma 1 Antibody (H00005335-M01)

Discover related pathways, diseases and genes to PLC-gamma 1 Antibody (H00005335-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLC-gamma 1 Antibody (H00005335-M01)

Discover more about diseases related to PLC-gamma 1 Antibody (H00005335-M01).
 

Pathways for PLC-gamma 1 Antibody (H00005335-M01)

View related products by pathway.

PTMs for PLC-gamma 1 Antibody (H00005335-M01)

Learn more about PTMs related to PLC-gamma 1 Antibody (H00005335-M01).
 

Research Areas for PLC-gamma 1 Antibody (H00005335-M01)

Find related products by research area.

Blogs on PLC-gamma 1

There are no specific blogs for PLC-gamma 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLC-gamma 1 Antibody (2A2) and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCG1
Entrez
OMIM
Uniprot