PLC-delta 3 Antibody - BSA Free Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: EGHQSEGLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLTKLRARLDAMSQRERLDHWIHSYLHRADSNQDSKMSFKEIKSLLRMVNVDMNDMYAYLLFK |
Predicted Species |
Mouse (96%), Rat (95%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PLCD3 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
Recommended conditions for IHC,Retrieval method: HIER pH6 |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Protein A purified |
Alternate Names for PLC-delta 3 Antibody - BSA Free
Background
PLCD3, also referred to as Phospholipase C-delta-3, is 789 amino acids in length and approximately 89kDa. PLCD3 is a member of the Phospholipase C family and functions to hydrolyze PIP2 to produce the second messangers DAG and IP3. Current research on PLCD3 is being conducted in relation to several diseases and disorders including breast cancer, glioblastoma, Huntington's disease and neurological diseases. PLCD3 has also been shown to have interactions with ITPR1, ITPR3, PIK3C3, DGKE and SKIL in pathways such as the CREB pathway, sweet taste signaling and Inositol phosphate metabolism.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Av, Bv, Sh
Applications: WB
Species: Hu
Applications: ICC, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC
Publications for PLC-delta 3 Antibody (NBP2-68706) (0)
There are no publications for PLC-delta 3 Antibody (NBP2-68706).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PLC-delta 3 Antibody (NBP2-68706) (0)
There are no reviews for PLC-delta 3 Antibody (NBP2-68706).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PLC-delta 3 Antibody (NBP2-68706) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PLC-delta 3 Products
Research Areas for PLC-delta 3 Antibody (NBP2-68706)
Find related products by research area.
|
Blogs on PLC-delta 3