We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Plasminogen Recombinant Protein Antigen

Images

 
There are currently no images for Plasminogen Protein (NBP1-86015PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Plasminogen Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLG.

Source: E. coli

Amino Acid Sequence: NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86015.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Plasminogen Recombinant Protein Antigen

  • DKFZp779M0222
  • EC 3.4.21
  • EC 3.4.21.7
  • plasmin
  • Plasminogen
  • Plg

Background

Plasminogen is a plasma protein synthesised mostly in the liver. Plasma concentration is usually in the range of 70 to 200mg/L. Plasminogen is activated by tissue plasminogen activator, urokinase and streptokinase, to form plasmin. Activation results from the cleavage and release of the preactivation peptide. Angiostatin, an internal fragment of plasminogen, is a potent inhibitor of angiogenesis, which selectively inhibits endothelial cell proliferation. Angiostatin potently inhibits tumor growth and can maintain metastatic and primary tumors in a dormant state. It is defined by a balance of proliferation and apoptosis of the tumor cells and is composed of plasminogen first four cringle structures. This molecule is generated by proteolytic cleavage of plasminogen.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DSE100
Species: Hu
Applications: ELISA
1310-SE
Species: Hu
Applications: EnzAct
DTPA00
Species: Hu
Applications: ELISA
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF1267
Species: Hu
Applications: IP, Neut, WB
NBP3-38499
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF1148
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-33188
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-80633
Species: Hu
Applications: IHC,  IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB100-96916
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DUP00
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP1-86015PEP
Species: Hu
Applications: AC

Publications for Plasminogen Protein (NBP1-86015PEP) (0)

There are no publications for Plasminogen Protein (NBP1-86015PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plasminogen Protein (NBP1-86015PEP) (0)

There are no reviews for Plasminogen Protein (NBP1-86015PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Plasminogen Protein (NBP1-86015PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Plasminogen Products

Research Areas for Plasminogen Protein (NBP1-86015PEP)

Find related products by research area.

Blogs on Plasminogen

There are no specific blogs for Plasminogen, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Plasminogen Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PLG