Plasminogen Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLG. Source: E. coli
Amino Acid Sequence: NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PLG |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86015. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Plasminogen Recombinant Protein Antigen
Background
Plasminogen is a plasma protein synthesised mostly in the liver. Plasma concentration is usually in the range of 70 to 200mg/L. Plasminogen is activated by tissue plasminogen activator, urokinase and streptokinase, to form plasmin. Activation results from the cleavage and release of the preactivation peptide. Angiostatin, an internal fragment of plasminogen, is a potent inhibitor of angiogenesis, which selectively inhibits endothelial cell proliferation. Angiostatin potently inhibits tumor growth and can maintain metastatic and primary tumors in a dormant state. It is defined by a balance of proliferation and apoptosis of the tumor cells and is composed of plasminogen first four cringle structures. This molecule is generated by proteolytic cleavage of plasminogen.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: IP, Neut, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: AC
Publications for Plasminogen Protein (NBP1-86015PEP) (0)
There are no publications for Plasminogen Protein (NBP1-86015PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Plasminogen Protein (NBP1-86015PEP) (0)
There are no reviews for Plasminogen Protein (NBP1-86015PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Plasminogen Protein (NBP1-86015PEP) (0)
Additional Plasminogen Products
Research Areas for Plasminogen Protein (NBP1-86015PEP)
Find related products by research area.
|
Blogs on Plasminogen