Plakophilin 2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PKP2. Source: E. coli
Amino Acid Sequence: VGNGNLHRTSSVPEYVYNLHLVENDFVGGRSPVPKTYDMLKAGTTATYEGRWGRGTAQYSSQKSVEERSLRHPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGHTLHHQESRRAALLVPPRY Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PKP2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86078. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Plakophilin 2 Recombinant Protein Antigen
Background
Plakophilins 1, 2, 3 and 4 (PKP1-4) influence development and participate in linking cadherins to cytoskeletal intermediate filaments. Plakophilins 1-4 contain arm-repeat (armadillo) domains and localize to nuclei and cell desmosomes (cell-cell junctions found in suprabasal layers of stratifying epithelia that undergo mechanical stress). Plakophilin 1 mediates increases in desmosomal protein content, desmosome assembly and regulation of cell migration. Plakophilin 2 is important for desmosome assembly and is an essential morphogenic factor and architectural component of the heart. Plakophilin 4 is a component of desmosomal adhesion plaques that regulates junctional plaque organization and cadherin function.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Simple Western, WB
Species: Mu
Applications: IHC
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: BA
Species: Bv, Ca, Ch, Fe, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Ca, Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: Flow, ICC/IF, WB
Species: Hu
Applications: AC
Publications for Plakophilin 2 Protein (NBP1-86078PEP) (0)
There are no publications for Plakophilin 2 Protein (NBP1-86078PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Plakophilin 2 Protein (NBP1-86078PEP) (0)
There are no reviews for Plakophilin 2 Protein (NBP1-86078PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Plakophilin 2 Protein (NBP1-86078PEP) (0)
Additional Plakophilin 2 Products
Research Areas for Plakophilin 2 Protein (NBP1-86078PEP)
Find related products by research area.
|
Blogs on Plakophilin 2