PLA2R1 Antibody

Images

 
Western Blot: PLA2R1 Antibody [NBP1-84449] - Analysis in human kidney tissue.
Immunohistochemistry-Paraffin: PLA2R1 Antibody [NBP1-84449] - Immunohistochemical staining of normal human kidney shows weak membranous positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: PLA2R1 Antibody [NBP1-84449] - Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: PLA2R1 Antibody [NBP1-84449] - Immunohistochemical staining of human kidney (idiopathic membranous nephropathy) shows strong membranous positivity in cells in glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLA2R1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLA2R1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:500-1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLA2R1 Protein (NBP1-84449PEP)
Publications
Read Publications using
NBP1-84449 in the following applications:

  • IHC
    2 publications
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23223223)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLA2R1 Antibody

  • 180 kDa secretory phospholipase A2 receptor
  • CLEC13C
  • CLEC13CC-type lectin domain family 13 member C
  • phospholipase A2 receptor 1, 180kDa
  • PLA2G1R
  • PLA2IR
  • PLA2R1
  • PLA2-RM-type receptor
  • PLA2Rphospholipase A2 receptor 1, 180kD
  • secretory phospholipase A2 receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5018
Species: Hu
Applications: WB, IP
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
H00008399-D01P
Species: Hu, Rt
Applications: WB
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for PLA2R1 Antibody (NBP1-84449)(8)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(2)
WB
(1)
All Applications
Filter By Species
Human
(3)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-84449 Applications Species
Iwakura T, Ohashi N, Kato A et al. Prevalence of Enhanced Granular Expression of Thrombospondin Type-1 Domain-Containing 7A in the Glomeruli of Japanese Patients with Idiopathic Membranous Nephropathy. PLoS One 2015 [PMID: 26393352] (IHC, Human) IHC Human
Dauvergne M, Moktefi A, Rabant M et al. Membranous Nephropathy Associated With Immunological Disorder-Related Liver Disease: A Retrospective Study of 10 Cases. Medicine (Baltimore) 2015 Jul [PMID: 26222864] (IHC, Human) IHC Human
Akiyama S, Akiyama M, Imai E et al. Prevalence of anti-phospholipase A2 receptor antibodies in Japanese patients with membranous nephropathy. Clin Exp Nephrol 2015 Aug [PMID: 25412738] (WB, Human) WB Human
Augert A, Vindrieux D, Girard CA et al. PLA2R1 kills cancer cells by inducing mitochondrial stress. Free Radic Biol Med 2013 Dec [PMID: 23994771]
Svobodova B, Honsova E, Ronco P et al. Kidney biopsy is a sensitive tool for retrospective diagnosis of PLA2R-related membranous nephropathy. Nephrol Dial Transplant 2013 Jul [PMID: 23223223]
Hoxha E, Kneibetaler U, Stege G et al. Enhanced expression of the M-type phospholipase A2 receptor in glomeruli correlates with serum receptor antibodies in primary membranous nephropathy. Kidney Int 2012 Oct [PMID: 22673885]
Debiec H, Martin L, Jouanneau C et al. Autoantibodies specific for the phospholipase A2 receptor in recurrent and?De Novo?membranous nephropathy. Am J Transplant 2011 Oct [PMID: 21827616]
Debiec H, Ronco P et al. PLA2R autoantibodies and PLA2R glomerular deposits in membranous nephropathy. N Engl J Med 2011 Feb [PMID: 21323563]

Reviews for PLA2R1 Antibody (NBP1-84449) (0)

There are no reviews for PLA2R1 Antibody (NBP1-84449). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLA2R1 Antibody (NBP1-84449). (Showing 1 - 1 of 1 FAQs).

  1. How many test can be performed in 0.1 ml of PLA2R1 Antibody (NBP1-84449). Also kindly suggest the secondary Antibody for the same.
    • The number of tests using NBP1-84449 will depend upon the sample type (differential tissues expression) and the total volume of antibody used in each slide. This product is supplied in 100ul size and the concentration of the antibody is 0.4ug/ul and the working dilution we recommend for IHC is 1:500 to 1:1000, based on this information you should be able to estimate how many experiments can be done with one vial. As far as secondary antibody is concerned, any anti rabbit IgG secondary that is conjugated should technical work, the type of conjugation does not matter as much, HRP is most often used in labs while the biotin-conjugated antibody is used to amplify the signal which results in greater sensitivity than that achieved with an enzyme or fluorescence conjugated secondary antibody alone. Fluorescent labeled antibodies are commonly used for double or multiple staining methods. Here is the list of our secondary antibodies. I can recommend NB730-H as it has received very good reviews from our customers and it has been cited in 23 publications as well. I hope this answers your question. Please do not hesitate to contact us if you have any further questions.

Secondary Antibodies

 

Isotype Controls

Additional PLA2R1 Products

Bioinformatics Tool for PLA2R1 Antibody (NBP1-84449)

Discover related pathways, diseases and genes to PLA2R1 Antibody (NBP1-84449). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLA2R1 Antibody (NBP1-84449)

Discover more about diseases related to PLA2R1 Antibody (NBP1-84449).
 

Pathways for PLA2R1 Antibody (NBP1-84449)

View related products by pathway.

PTMs for PLA2R1 Antibody (NBP1-84449)

Learn more about PTMs related to PLA2R1 Antibody (NBP1-84449).

Blogs on PLA2R1

There are no specific blogs for PLA2R1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLA2R1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2R1
Entrez
Uniprot