PLA2G6 Antibody

Images

 
Western Blot: PLA2G6 Antibody [NBP1-81586] - Effects of APPWT and APPOSK overexpression on the levels of the major phospholipase A2s in the brains of old mice. Cerebrum samples from non-Tg, APPWT and APPOSK were ...read more
Immunocytochemistry/ Immunofluorescence: PLA2G6 Antibody [NBP1-81586] - Staining of human cell line A-431 shows localization to microtubule organizing center. Antibody staining is shown in green.
Immunohistochemistry: PLA2G6 Antibody [NBP1-81586] - Non-Tg mouse brains were dissected, fixed in 4% paraformaldehyde, cryoprotected, frozen, & sectioned coronally (8 um sections). Representative immunofluorescence ...read more
Western Blot: PLA2G6 Antibody [NBP1-81586] - Analysis in human cell line HEL.
Western Blot: PLA2G6 Antibody [NBP1-81586] - Analysis in control (vector only transfected HEK293T lysate) and PLA2G6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLA2G6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLA2G6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P reported in (PMID: 28213071).
Control Peptide
PLA2G6 Recombinant Protein Antigen (NBP1-81586PEP)
Publications
Read Publications using
NBP1-81586 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLA2G6 Antibody

  • calcium-independent phospholipase A2
  • EC 3.1.1.4
  • Group VI phospholipase A2
  • IPLA2
  • iPLA285 kDa calcium-independent phospholipase A2
  • IPLA2-VIA
  • NBIA2A
  • NBIA2B
  • PARK14GVI
  • patatin-like phospholipase domain containing 9
  • phospholipase A2, group VI (cytosolic, calcium-independent)
  • PNPLA9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00151056-B01P
Species: Hu, Mu
Applications: WB
MAB5018
Species: Hu
Applications: IP, WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
AF4925
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-31344
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24613
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF2364
Species: Hu
Applications: IHC, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00008399-D01P
Species: Hu, Rt
Applications: WB
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP1-59069
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
201-LB/CF
Species: Hu
Applications: BA
NBP1-81586
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PLA2G6 Antibody (NBP1-81586)(3)

Reviews for PLA2G6 Antibody (NBP1-81586) (0)

There are no reviews for PLA2G6 Antibody (NBP1-81586). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PLA2G6 Antibody (NBP1-81586) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PLA2G6 Products

Bioinformatics Tool for PLA2G6 Antibody (NBP1-81586)

Discover related pathways, diseases and genes to PLA2G6 Antibody (NBP1-81586). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLA2G6 Antibody (NBP1-81586)

Discover more about diseases related to PLA2G6 Antibody (NBP1-81586).
 

Pathways for PLA2G6 Antibody (NBP1-81586)

View related products by pathway.

PTMs for PLA2G6 Antibody (NBP1-81586)

Learn more about PTMs related to PLA2G6 Antibody (NBP1-81586).

Blogs on PLA2G6

There are no specific blogs for PLA2G6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLA2G6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G6