PLA2G4C Antibody

Images

 
Western Blot: PLA2G4C Antibody [NBP1-85480] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry-Paraffin: PLA2G4C Antibody [NBP1-85480] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLA2G4C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLA2G4C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLA2G4C Protein (NBP1-85480PEP)
Publications
Read Publication using NBP1-85480.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23015700)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLA2G4C Antibody

  • cPLA2-gamma
  • cytosolic phospholipase A2 gamma
  • DKFZp586C0423
  • EC 3.1.1.4
  • FLJ42247
  • FLJ44164
  • Phospholipase A2 group IVC
  • phospholipase A2, group IVC (cytosolic, calcium-independent)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5018
Species: Hu
Applications: WB, IP
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-15106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-59576
Species: Hu
Applications: WB, IHC
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85480
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PLA2G4C Antibody (NBP1-85480)(1)


Reviews for PLA2G4C Antibody (NBP1-85480) (0)

There are no reviews for PLA2G4C Antibody (NBP1-85480). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLA2G4C Antibody (NBP1-85480) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLA2G4C Products

Bioinformatics Tool for PLA2G4C Antibody (NBP1-85480)

Discover related pathways, diseases and genes to PLA2G4C Antibody (NBP1-85480). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLA2G4C Antibody (NBP1-85480)

Discover more about diseases related to PLA2G4C Antibody (NBP1-85480).
 

Pathways for PLA2G4C Antibody (NBP1-85480)

View related products by pathway.

PTMs for PLA2G4C Antibody (NBP1-85480)

Learn more about PTMs related to PLA2G4C Antibody (NBP1-85480).

Blogs on PLA2G4C

There are no specific blogs for PLA2G4C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLA2G4C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G4C