PLA2G4C Antibody - BSA Free

Immunohistochemistry-Paraffin: PLA2G4C Antibody [NBP1-85480] - Staining of human prostate shows strong membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PLA2G4C Antibody [NBP1-85480] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: PLA2G4C Antibody [NBP1-85480] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PLA2G4C Antibody [NBP1-85480] - Staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PLA2G4C Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLA2G4C
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot Reported in scientific literature (PMID: 29709018)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PLA2G4C Protein (NBP1-85480PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PLA2G4C Antibody - BSA Free

• cPLA2-gamma
• cytosolic phospholipase A2 gamma
• DKFZp586C0423
• EC 3.1.1.4
• FLJ42247
• FLJ44164
• Phospholipase A2 group IVC
• phospholipase A2, group IVC (cytosolic, calcium-independent)

Background

PLA2G4C, also known as Cytosolic phospholipase A2 gamma, has 3 isoforms, a 541 amino acid isoform that is 61 kDa, a 527 amino acid isoform that is 59 kDa and a 551 amino acid isoform that is 62 kDa; highly expressed in heart and skeletal muscle; hydrolyzes glycerophospholipids to produce free fatty acids and lysophospholipids, both of which serve as precursors in the production of signaling molecules has been shown to be a calcium-independent and membrane bound enzyme, and has a preference for arachidonic acid at the sn-2 position of phosphatidylcholine as compared with palmitic acid. This protein has being studied for its involvement in oligodendroglioma, ovarian cancer, breast cancer, schizophrenia, and neuronitis. PLA2G4C protein has been observed with relation to S100A10, MBOAT2, GPCPD1, LPCAT1, and LPCAT2 in immune response CD16 signaling in NK cells, development Leptin signaling via JAK/STAT and MAPK cascades, development Alpha-2 adrenergic receptor activation of ERK, immune response CCR3 signaling in eosinophils, neurophysiological process PGE2-induced pain processing, chemokine signaling, DHA signaling, VEGF family ligands and receptor interactions, antioxidant action of vitamin-C, LDL oxidation in atherogenesis, phospholipases, acyl chain remodelling of PE, metabolism, acyl chain remodelling of PC, hydrolysis of LPC, and phospholipid metabolism pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PLA2G4C Antibody (NBP1-85480)(2)

Publications using NBP1-85480

• Liebscher S, Ambrose RL, Aktepe TE et al. Phospholipase A2 activity during the replication cycle of the flavivirus West Nile virus PLoS Pathog. 2018-04-01 [PMID: 29709018] (WB, Human)
• Xu S, Pei R, Guo M et al. Cytosolic Phospholipase A2 Gamma Is Involved in Hepatitis C Virus Replication and Assembly. J Virol 2012-12-01 [PMID: 23015700]

Bioinformatics

• Gene Symbol: PLA2G4C