PLA1A Antibody

Images

 
Western Blot: PLA1A Antibody [NBP1-58036] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLA1A Antibody Summary

Immunogen
Synthetic peptides corresponding to PLA1A(phospholipase A1 member A) The peptide sequence was selected from the middle region of PLA1A. Peptide sequence TDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLA1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PLA1A and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PLA1A Antibody

  • EC 3.1.1
  • EC 3.1.1.-
  • NMD
  • phosphatidylserine-specific phospholipase A1alpha
  • phospholipase A1 member A
  • PS-PLA1
  • PSPLA1Phosphatidylserine-specific phospholipase A1

Background

Phosphatidylserine-specific phospholipase A1-alpha (PLA1A) acts specifically on phosphatidylserine (PS) and 1-acyl-2-lysophosphatidylserine (lyso-PS) to hydrolyze fatty acids at the sn-1 position of these phospholipids.Phosphatidylserine-specific phospholipase A1-alpha (PLA1A) acts specifically on phosphatidylserine (PS) and 1-acyl-2-lysophosphatidylserine (lyso-PS) to hydrolyze fatty acids at the sn-1 position of these phospholipids.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-368
Species: Hu
Applications: WB
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20813
Species: Hu, Mu
Applications: WB, ICC/IF
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
H00065110-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-57526
Species: Hu
Applications: ICC/IF
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38045
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-13279
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for PLA1A Antibody (NBP1-58036) (0)

There are no publications for PLA1A Antibody (NBP1-58036).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLA1A Antibody (NBP1-58036) (0)

There are no reviews for PLA1A Antibody (NBP1-58036). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLA1A Antibody (NBP1-58036) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLA1A Products

Bioinformatics Tool for PLA1A Antibody (NBP1-58036)

Discover related pathways, diseases and genes to PLA1A Antibody (NBP1-58036). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLA1A Antibody (NBP1-58036)

Discover more about diseases related to PLA1A Antibody (NBP1-58036).
 

Pathways for PLA1A Antibody (NBP1-58036)

View related products by pathway.

PTMs for PLA1A Antibody (NBP1-58036)

Learn more about PTMs related to PLA1A Antibody (NBP1-58036).

Blogs on PLA1A

There are no specific blogs for PLA1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLA1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA1A
Uniprot