PLA1A Antibody


Western Blot: PLA1A Antibody [NBP1-58036] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PLA1A Antibody Summary

Synthetic peptides corresponding to PLA1A(phospholipase A1 member A) The peptide sequence was selected from the middle region of PLA1A. Peptide sequence TDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLY.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PLA1A and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PLA1A Antibody

  • EC 3.1.1
  • EC 3.1.1.-
  • NMD
  • phosphatidylserine-specific phospholipase A1alpha
  • phospholipase A1 member A
  • PS-PLA1
  • PSPLA1Phosphatidylserine-specific phospholipase A1


Phosphatidylserine-specific phospholipase A1-alpha (PLA1A) acts specifically on phosphatidylserine (PS) and 1-acyl-2-lysophosphatidylserine (lyso-PS) to hydrolyze fatty acids at the sn-1 position of these phospholipids.Phosphatidylserine-specific phospholipase A1-alpha (PLA1A) acts specifically on phosphatidylserine (PS) and 1-acyl-2-lysophosphatidylserine (lyso-PS) to hydrolyze fatty acids at the sn-1 position of these phospholipids.[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IP, PLA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for PLA1A Antibody (NBP1-58036) (0)

There are no publications for PLA1A Antibody (NBP1-58036).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLA1A Antibody (NBP1-58036) (0)

There are no reviews for PLA1A Antibody (NBP1-58036). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLA1A Antibody (NBP1-58036) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PLA1A Products

Bioinformatics Tool for PLA1A Antibody (NBP1-58036)

Discover related pathways, diseases and genes to PLA1A Antibody (NBP1-58036). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLA1A Antibody (NBP1-58036)

Discover more about diseases related to PLA1A Antibody (NBP1-58036).

Pathways for PLA1A Antibody (NBP1-58036)

View related products by pathway.

PTMs for PLA1A Antibody (NBP1-58036)

Learn more about PTMs related to PLA1A Antibody (NBP1-58036).

Blogs on PLA1A

There are no specific blogs for PLA1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PLA1A Antibody and receive a gift card or discount.


Gene Symbol PLA1A