PKM2 Antibody (2D8)

Images

 
Immunocytochemistry/ Immunofluorescence: PKM2 Antibody (2D8) [H00005315-M08] - Analysis of monoclonal antibody to PKM2 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: PKM2 Antibody (2D8) [H00005315-M08] - Detection limit for recombinant GST tagged PKM2 is 10 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
2D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PKM2 Antibody (2D8) Summary

Immunogen
PKM2 (NP_002645 436 a.a. - 531 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
Specificity
PKM2 - pyruvate kinase, muscle (2D8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PKM
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PKM2 Antibody (2D8)

  • CTHBP
  • Cytosolic thyroid hormone-binding protein
  • MGC3932
  • OIP3
  • OIP-3
  • OIP3EC 2.7.1.40
  • Opa-interacting protein 3
  • p58
  • PK, muscle type
  • PK2
  • PK3
  • PK3PKM
  • PKM2
  • Pyruvate kinase 2/3
  • pyruvate kinase isozymes M1/M2
  • Pyruvate kinase muscle isozyme
  • pyruvate kinase, muscle
  • TCB
  • THBP1
  • THBP1p58
  • Thyroid hormone-binding protein 1
  • thyroid hormone-binding protein, cytosolic
  • Tumor M2-PK

Background

The protein encoded by this gene is a pyruvate kinase that catalyzes the production of phosphoenolpyruvate from pyruvate and ATP. This protein has been shown to interact with thyroid hormone, and thus may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-43853
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P
NB100-2901
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-57614
Species: Hu
Applications: ICC/IF
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33137
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP1-92290
Species: Hu
Applications: IHC, IHC-P
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB4655
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
H00005315-M08
Species: Hu
Applications: ELISA, ICC/IF

Publications for PKM2 Antibody (H00005315-M08) (0)

There are no publications for PKM2 Antibody (H00005315-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKM2 Antibody (H00005315-M08) (0)

There are no reviews for PKM2 Antibody (H00005315-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PKM2 Antibody (H00005315-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKM2 Products

Bioinformatics Tool for PKM2 Antibody (H00005315-M08)

Discover related pathways, diseases and genes to PKM2 Antibody (H00005315-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKM2 Antibody (H00005315-M08)

Discover more about diseases related to PKM2 Antibody (H00005315-M08).
 

Pathways for PKM2 Antibody (H00005315-M08)

View related products by pathway.

PTMs for PKM2 Antibody (H00005315-M08)

Learn more about PTMs related to PKM2 Antibody (H00005315-M08).
 

Research Areas for PKM2 Antibody (H00005315-M08)

Find related products by research area.

Blogs on PKM2.

MAPK3/ERK1 - A signal transduction pathway with roles in development and disease
Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos...  Read full blog post.

5 Stars for the PKM2 Antibody
Novus' Pyruvate Kinase M2 antibody (cat # NBP1-48308) has received some glowing product reviews and customer feedback lately. One satisfied customer wrote, "The best thing about this antibody is that it works well for immunofluorescence staining of fr...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKM2 Antibody (2D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol PKM
Entrez
Uniprot