PKIG Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PKIG Antibody [NBP1-86212] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: PKIG Antibody [NBP1-86212] - Staining of human rectum shows strong nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PKIG Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PKIG
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PKIG Protein (NBP1-86212PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PKIG Antibody - BSA Free

• cAMP-dependent protein kinase inhibitor gamma
• MGC126458
• MGC126459
• PKI-gamma
• protein kinase (cAMP-dependent, catalytic) inhibitor gamma

Background

PKIG is encoded by this gene is a member of the cAMP-dependent protein kinase (PKA) inhibitor family. Studies of a similar protein in mice suggest that this protein acts as a potent competitive PKA inhibitor, and is a predominant form of PKA inhibitors in various tissues. Three alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PKIG