PKC zeta Antibody (2D1)

Images

 
Western Blot: PKC zeta Antibody (2D1) [H00005590-M01] - Analysis of PRKCZ expression in transfected 293T cell line by PRKCZ monoclonal antibody (M01), clone 2D1.Lane 1: PRKCZ transfected lysate(67.7 KDa).Lane 2: ...read more
Western Blot: PKC zeta Antibody (2D1) [H00005590-M01] - Analysis of PRKCZ over-expressed 293 cell line, cotransfected with PRKCZ Validated Chimera RNAi ( Cat # H00005590-R01V ) (Lane 2) or non-transfected control (Lane ...read more
Sandwich ELISA: PKC zeta Antibody (2D1) [H00005590-M01] - Detection limit for recombinant GST tagged PRKCZ is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi
Clone
2D1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PKC zeta Antibody (2D1) Summary

Immunogen
PRKCZ (AAH08058 165 a.a. - 255 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLI
Localization
Cytoplasmic and endosome
Specificity
PRKCZ - protein kinase C, zeta
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRKCZ
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PKC zeta Antibody (2D1)

  • EC 2.7.11
  • EC 2.7.11.13
  • nPKC-zeta
  • PKC zeta
  • PKC2
  • PKC2PKC-ZETA
  • PRKCZ
  • protein kinase C zeta type
  • protein kinase C, zeta

Background

Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB600-201
Species: Hu, Mu, Rt, Po, Bv, Ca, Fi, Rb, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
NBP2-19846
Species: Hu, Rt
Applications: WB, Func, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4585
Species: Hu
Applications: WB
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-46403
Species: Hu
Applications: IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
AF5130
Species: Hu, Mu, Rt
Applications: WB
AF5134
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for PKC zeta Antibody (H00005590-M01) (0)

There are no publications for PKC zeta Antibody (H00005590-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKC zeta Antibody (H00005590-M01) (0)

There are no reviews for PKC zeta Antibody (H00005590-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PKC zeta Antibody (H00005590-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKC zeta Products

Bioinformatics Tool for PKC zeta Antibody (H00005590-M01)

Discover related pathways, diseases and genes to PKC zeta Antibody (H00005590-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKC zeta Antibody (H00005590-M01)

Discover more about diseases related to PKC zeta Antibody (H00005590-M01).
 

Pathways for PKC zeta Antibody (H00005590-M01)

View related products by pathway.

PTMs for PKC zeta Antibody (H00005590-M01)

Learn more about PTMs related to PKC zeta Antibody (H00005590-M01).
 

Research Areas for PKC zeta Antibody (H00005590-M01)

Find related products by research area.

Blogs on PKC zeta

There are no specific blogs for PKC zeta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKC zeta Antibody (2D1) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKCZ
Entrez
OMIM
Uniprot