PKC iota Antibody (3A7)

Images

 
Western Blot: PKC iota Antibody (3A7) [H00005584-M02] - PRKCI monoclonal antibody (M02), clone 3A7 Analysis of PRKCI expression in Hela S3 NE.
Sandwich ELISA: PKC iota Antibody (3A7) [H00005584-M02] - Detection limit for recombinant GST tagged PRKCI is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PKC iota Antibody (3A7) Summary

Immunogen
PRKCI (AAH22016, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCV
Specificity
PRKCI - protein kinase C, iota
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRKCI
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PKC iota Antibody (3A7)

  • aPKC-lambda/iota
  • Atypical protein kinase C-lambda/iota
  • DXS1179E
  • EC 2.7.11
  • EC 2.7.11.13
  • MGC26534
  • nPKC-iota
  • PKCI
  • PRKC-lambda/iota
  • protein kinase C iota type
  • protein kinase C, iota

Background

This gene encodes a member of the protein kinase C (PKC) family of serine/threonine protein kinases. The PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes. This protein kinase is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol. This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction with the small GTPase RAB2, where this kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics in the early secretory pathway. This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis and therefore protects leukemia cells against drug-induced apoptosis. There is a single exon pseudogene mapped on chromosome X.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-83257
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89062
Species: Hu
Applications: WB, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
MAB5018
Species: Hu
Applications: WB, IP
AF7979
Species: Hu, Mu, Rt
Applications: WB
NBP1-86990
Species: Hu
Applications: WB, IHC, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005584-M02
Species: Hu
Applications: WB, ELISA

Publications for PKC iota Antibody (H00005584-M02) (0)

There are no publications for PKC iota Antibody (H00005584-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKC iota Antibody (H00005584-M02) (0)

There are no reviews for PKC iota Antibody (H00005584-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PKC iota Antibody (H00005584-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKC iota Products

Bioinformatics Tool for PKC iota Antibody (H00005584-M02)

Discover related pathways, diseases and genes to PKC iota Antibody (H00005584-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKC iota Antibody (H00005584-M02)

Discover more about diseases related to PKC iota Antibody (H00005584-M02).
 

Pathways for PKC iota Antibody (H00005584-M02)

View related products by pathway.

PTMs for PKC iota Antibody (H00005584-M02)

Learn more about PTMs related to PKC iota Antibody (H00005584-M02).
 

Research Areas for PKC iota Antibody (H00005584-M02)

Find related products by research area.

Blogs on PKC iota

There are no specific blogs for PKC iota, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKC iota Antibody (3A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKCI
Entrez
OMIM
Uniprot