PKC delta Recombinant Protein Antigen

Images

 
There are currently no images for PKC delta Recombinant Protein Antigen (NBP1-90351PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PKC delta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKCD.

Source: E. coli

Amino Acid Sequence: ANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRKCD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90351.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PKC delta Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.13
  • MAY1
  • MGC49908
  • nPKC-delta
  • PKC delta
  • PKCD
  • PKCy
  • PRKCD
  • protein kinase C delta type
  • protein kinase C delta VIII
  • protein kinase C, delta

Background

PKC-delta has a biological activity which is closely related to Pkc1, and PKC-delta activates the Pkc1-mediated pathway through an activation of the Bck1 kinase. PKC-delta appears to play a critical role in growth control of yeast and mammalian cells. Suppression experiments suggest that PKC-delta desensitizes the pathway by regulating an aspect of G protein function (1). PKC-delta phosphorylates hRad9 in vitro and in cells exposed to genotoxic agents. It has been shown that PKC-delta is required for binding of hRad9 to Bcl-2. In concert with these results, inhibition of PKC-delta attenuates Rad9-mediated apoptosis. These findings demonstrate that PKC-delta is responsible for the regulation of Rad9 in the Hus1-Rad1 complex and in the apoptotic response to DNA damage (2). It has been reported a mechanism for the regulation of peripheral B-cell survival by serine/threonine protein kinase Cdelta (PKC-delta): spontaneous death of resting B cells is regulated by nuclear localization of PKC-delta that contributes to phosphorylation of histone H2B at serine 14 (S14-H2B) (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB600-201
Species: Pm, Bv, Ca, Ch, Fi, Hu, Pm, Mu, Po, Rb, Rt, Sh, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, RIA, WB
AF5134
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-91228
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP1-90351PEP
Species: Hu
Applications: AC

Publications for PKC delta Recombinant Protein Antigen (NBP1-90351PEP) (0)

There are no publications for PKC delta Recombinant Protein Antigen (NBP1-90351PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKC delta Recombinant Protein Antigen (NBP1-90351PEP) (0)

There are no reviews for PKC delta Recombinant Protein Antigen (NBP1-90351PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PKC delta Recombinant Protein Antigen (NBP1-90351PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PKC delta Products

Research Areas for PKC delta Recombinant Protein Antigen (NBP1-90351PEP)

Find related products by research area.

Blogs on PKC delta

There are no specific blogs for PKC delta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PKC delta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKCD