PKC delta Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKCD. Source: E. coli
Amino Acid Sequence: ANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDH Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PRKCD |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90351. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for PKC delta Recombinant Protein Antigen
Background
PKC-delta has a biological activity which is closely related to Pkc1, and PKC-delta activates the Pkc1-mediated pathway through an activation of the Bck1 kinase. PKC-delta appears to play a critical role in growth control of yeast and mammalian cells. Suppression experiments suggest that PKC-delta desensitizes the pathway by regulating an aspect of G protein function (1). PKC-delta phosphorylates hRad9 in vitro and in cells exposed to genotoxic agents. It has been shown that PKC-delta is required for binding of hRad9 to Bcl-2. In concert with these results, inhibition of PKC-delta attenuates Rad9-mediated apoptosis. These findings demonstrate that PKC-delta is responsible for the regulation of Rad9 in the Hus1-Rad1 complex and in the apoptotic response to DNA damage (2). It has been reported a mechanism for the regulation of peripheral B-cell survival by serine/threonine protein kinase Cdelta (PKC-delta): spontaneous death of resting B cells is regulated by nuclear localization of PKC-delta that contributes to phosphorylation of histone H2B at serine 14 (S14-H2B) (3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Pm, Bv, Ca, Ch, Fi, Hu, Pm, Mu, Po, Rb, Rt, Sh, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: AC
Publications for PKC delta Recombinant Protein Antigen (NBP1-90351PEP) (0)
There are no publications for PKC delta Recombinant Protein Antigen (NBP1-90351PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PKC delta Recombinant Protein Antigen (NBP1-90351PEP) (0)
There are no reviews for PKC delta Recombinant Protein Antigen (NBP1-90351PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for PKC delta Recombinant Protein Antigen (NBP1-90351PEP) (0)
Additional PKC delta Products
Research Areas for PKC delta Recombinant Protein Antigen (NBP1-90351PEP)
Find related products by research area.
|
Blogs on PKC delta