Recombinant Human PKA C-gamma Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PKA C-gamma Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human PKA C-gamma

Source: Wheat Germ

Amino Acid Sequence: MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAID

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PRKACG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PKA C-gamma Protein

  • cAMP-dependent protein kinase catalytic subunit gamma
  • EC 2.7.11
  • EC 2.7.11.11
  • KAPG
  • PKA C-gamma
  • PKACg
  • protein kinase, cAMP-dependent, catalytic, gamma
  • serine(threonine) protein kinase

Background

Cyclic AMP-dependent protein kinase (PKA) consists of two catalytic subunits and a regulatory subunit dimer. This gene encodes the gamma form of its catalytic subunit. The gene is intronless and is thought to be a retrotransposon derived from the gene for the alpha form of the PKA catalytic subunit. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-87832
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5908
Species: Hu, Mu, Rt
Applications: WB
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-376
Species: Hu
Applications: IP (-), WB, IP, PLA, KD
NB100-379
Species: Hu, Mu
Applications: WB, IP
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00009578-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38142
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84908
Species: Hu
Applications: WB, IHC, IHC-P
H00005568-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PKA C-gamma Partial Recombinant Protein (H00005568-Q01) (0)

There are no publications for PKA C-gamma Partial Recombinant Protein (H00005568-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKA C-gamma Partial Recombinant Protein (H00005568-Q01) (0)

There are no reviews for PKA C-gamma Partial Recombinant Protein (H00005568-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PKA C-gamma Partial Recombinant Protein (H00005568-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PKA C-gamma Products

Bioinformatics Tool for PKA C-gamma Partial Recombinant Protein (H00005568-Q01)

Discover related pathways, diseases and genes to PKA C-gamma Partial Recombinant Protein (H00005568-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKA C-gamma Partial Recombinant Protein (H00005568-Q01)

Discover more about diseases related to PKA C-gamma Partial Recombinant Protein (H00005568-Q01).
 

Pathways for PKA C-gamma Partial Recombinant Protein (H00005568-Q01)

View related products by pathway.

Research Areas for PKA C-gamma Partial Recombinant Protein (H00005568-Q01)

Find related products by research area.

Blogs on PKA C-gamma

There are no specific blogs for PKA C-gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PKA C-gamma Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKACG