PKA C beta Recombinant Protein Antigen

Images

 
There are currently no images for PKA C beta Protein (NBP1-80901PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PKA C beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKACB.

Source: E. coli

Amino Acid Sequence: MAAYREPPCNQYTGTTTALQKLEGFASRLFHRHSKGTAHDQKTALENDSLHFSEHTALWDRSMKEFLAKAKEDFLKKWENPTQNNAGLEDFER

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRKACB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80901.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PKA C beta Recombinant Protein Antigen

  • cAMP-dependent protein kinase catalytic beta subunit isoform 4ab
  • cAMP-dependent protein kinase catalytic subunit beta
  • cAPKbeta
  • DKFZp781I2452
  • EC 2.7.11
  • EC 2.7.11.11
  • MGC41879
  • MGC9320
  • PKA C beta
  • PKA C-beta
  • PKACb
  • PRKACB
  • protein kinase A catalytic subunit beta
  • protein kinase, cAMP-dependent, catalytic, beta

Background

The second messenger cyclic AMP (cAMP) mediates diverse cellular responses to external signals such as proliferation, ion transport, regulation of metabolism and gene transcription by activation of the cAMP-dependent protein kinase (cAPK or PKA). Activation of PKA occurs when cAMP binds to the two regulatory subunits of the tetrameric PKA holoenzyme resulting in release of active catalytic subunits. Three catalytic (C) subunits have been identified, designated Calpha, Cbeta and Cgamma, that each represent specific gene products. Calpha and Cbeta are closely related (93% amino acid sequence similarity), whereas Cgamma displays 83% and 79% similarity to Calpha and Cbeta, respectively. Activation of transcription upon elevation of cAMP levels results from translocation of PKA to the nucleus where it phosphorylates the transcription factor cAMP response element binding protein (CREB) on serine 133 which in turn leads to TFIIB binding to TATA-box-binding protein TBP1, thus linking phospho-CREB to the pol II transcription initiation complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-201
Species: Pm, Bv, Ca, Ch, Fi, Hu, Pm, Mu, Po, Rb, Rt, Sh, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, RIA, WB
MAB5908
Species: Hu, Mu, Rt
Applications: WB
NBP1-87426
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1494
Species: Hu, Mu, Rt
Applications: Block, IHC, Simple Western, WB
DBD00
Species: Hu
Applications: ELISA
NBP1-47935
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
201-LB
Species: Hu
Applications: BA
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00002263-M01
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-45802
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80901PEP
Species: Hu
Applications: AC

Publications for PKA C beta Protein (NBP1-80901PEP) (0)

There are no publications for PKA C beta Protein (NBP1-80901PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKA C beta Protein (NBP1-80901PEP) (0)

There are no reviews for PKA C beta Protein (NBP1-80901PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PKA C beta Protein (NBP1-80901PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PKA C beta Products

Research Areas for PKA C beta Protein (NBP1-80901PEP)

Find related products by research area.

Blogs on PKA C beta

There are no specific blogs for PKA C beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PKA C beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKACB