PKA 2 beta Recombinant Protein Antigen

Images

 
There are currently no images for PKA 2 beta Recombinant Protein Antigen (NBP3-17753PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PKA 2 beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PKA 2 beta

Source: E. coli

Amino Acid Sequence: LKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRKAR2B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17753.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PKA 2 beta Recombinant Protein Antigen

  • cAMP-dependent protein kinase type II-beta regulatory chain
  • cAMP-dependent protein kinase type II-beta regulatory subunit
  • H_RG363E19.2
  • PKA 2 beta
  • PRKAR2
  • PRKAR2B
  • protein kinase, cAMP-dependent, regulatory, type II, beta
  • RII-BETA
  • WUGSC:H_RG363E19.2

Background

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. This subunit has been shown to interact with and suppress the transcriptional activity of the cAMP responsive element binding protein 1 (CREB1) in activated T cells. Knockout studies in mice suggest that this subunit may play an important role in regulating energy balance and adiposity. The studies also suggest that this subunit may mediate the gene induction and cataleptic behavior induced by haloperidol.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47935
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02520
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89172
Species: Hu
Applications: IHC,  IHC-P, WB
AF4177
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NBP2-38713
Species: Hu
Applications: IHC,  IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-84310
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
314-BP
Species: Hu
Applications: BA, BA
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
MAB4500
Species: Hu
Applications: CyTOF-ready, ICFlow
243-B3
Species: Hu
Applications: BA

Publications for PKA 2 beta Recombinant Protein Antigen (NBP3-17753PEP) (0)

There are no publications for PKA 2 beta Recombinant Protein Antigen (NBP3-17753PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKA 2 beta Recombinant Protein Antigen (NBP3-17753PEP) (0)

There are no reviews for PKA 2 beta Recombinant Protein Antigen (NBP3-17753PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PKA 2 beta Recombinant Protein Antigen (NBP3-17753PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PKA 2 beta Products

Research Areas for PKA 2 beta Recombinant Protein Antigen (NBP3-17753PEP)

Find related products by research area.

Blogs on PKA 2 beta

There are no specific blogs for PKA 2 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PKA 2 beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKAR2B