PIWIL4 Antibody

Images

 
Immunohistochemistry-Paraffin: PIWIL4 Antibody [NBP1-83491] - Staining of human testis shows distinct cytoplasmic positivity in seminiferus duct cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIWIL4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYVDPDVQLVMCILPSNQKTYYDSI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIWIL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PIWIL4 Protein (NBP1-83491PEP)
Publications
Read Publication using NBP1-83491.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIWIL4 Antibody

  • DKFZp686P01248
  • FLJ36156
  • HIWI2
  • HIWI2MIWI2
  • MIWI2
  • PIWI
  • PIWIL4
  • piwi-like 4 (Drosophila)
  • piwi-like protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6548
Species: Hu, Mu
Applications: IHC
NBP2-24590
Species: Mu
Applications: WB, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP2-13951
Species: Hu
Applications: IHC, IHC-P
AF2030
Species: Hu
Applications: WB, IHC
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
AF6296
Species: Hu
Applications: WB
NBP2-31855
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87892
Species: Hu
Applications: IHC, IHC-P
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP2-57022
Species: Hu
Applications: WB, ICC/IF
H00004807-T01
Species: Hu
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-32620
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38122
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for PIWIL4 Antibody (NBP1-83491)(1)

Reviews for PIWIL4 Antibody (NBP1-83491) (0)

There are no reviews for PIWIL4 Antibody (NBP1-83491). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PIWIL4 Antibody (NBP1-83491) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIWIL4 Products

Bioinformatics Tool for PIWIL4 Antibody (NBP1-83491)

Discover related pathways, diseases and genes to PIWIL4 Antibody (NBP1-83491). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIWIL4 Antibody (NBP1-83491)

Discover more about diseases related to PIWIL4 Antibody (NBP1-83491).
 

Pathways for PIWIL4 Antibody (NBP1-83491)

View related products by pathway.

PTMs for PIWIL4 Antibody (NBP1-83491)

Learn more about PTMs related to PIWIL4 Antibody (NBP1-83491).

Blogs on PIWIL4

There are no specific blogs for PIWIL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIWIL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIWIL4
Entrez