![Immunohistochemistry: PIWIL4 Antibody [NBP1-83491] - Immunohistochemistry of protein expression of Piwil4 E, F in patient lymph nodes. Arrows indicate representative HRS cells. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/article/10015/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/PIWIL4-Antibody-Immunohistochemistry-NBP1-83491-img0003.jpg "Immunohistochemistry: PIWIL4 Antibody [NBP1-83491] - Immunohistochemistry of protein expression of Piwil4 E, F in patient lymph nodes. Arrows indicate representative HRS cells. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/article/10015/) licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYVDPDVQLVMCILPSNQKTYYDSI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PIWIL4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-83491 | Applications | Species |
|---|---|---|
| Cordeiro A, Navarro A, Gaya A et al. PiwiRNA-651 as marker of treatment response and survival in classical Hodgkin lymphoma. Oncotarget 2016-06-14 [PMID: 27329591] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PIWIL4 |
![Immunohistochemistry-Paraffin: PIWIL4 Antibody [NBP1-83491] - Immunohistochemistry of protein expression of Piwil1A, B. Piwil2 C, D. & Piwil4 E, F. in patient lymph nodes. Arrows indicate representative HRS cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/27329591), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-83491_rabbit-polyclonal-piwil4-antibody-310202415171337.jpg "Immunohistochemistry-Paraffin: PIWIL4 Antibody [NBP1-83491] - Immunohistochemistry of protein expression of Piwil1A, B. Piwil2 C, D. & Piwil4 E, F. in patient lymph nodes. Arrows indicate representative HRS cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/27329591), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Western_Blot_16711.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Immunohistochemistry_7144.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images/af2030_human-vasa-affinity-purified-polyclonal-ab-4120241239493.jpg)
![Immunocytochemistry Goosecoid Antibody [Unconjugated]](https://images.novusbio.com/images2/Goosecoid_AF4086_Immunocytochemistry__Immunofluorescence_20128.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")