Recombinant Human PITX1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PITX1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 225 - 313 of Human PITX1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PITX1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PITX1 Protein

  • BFTpituitary homeobox 1
  • CCF
  • Hindlimb-expressed homeobox protein backfoot
  • Homeobox protein PITX1
  • paired-like homeodomain 1
  • pituitary otx-related factor
  • POTXpituitary homeo box 1
  • PTX1Paired-like homeodomain transcription factor 1hindlimb expressed homeobox protein backfoot

Background

PITX1 - paired-like homeodomain transcription factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-61438
Species: Hu
Applications: IHC-P
NBP2-58195
Species: Hu
Applications: ICC/IF
423-F8/CF
Species: Hu, Mu
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00008022-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
AF8016
Species: Hu
Applications: WB, IHC
H00005307-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PITX1 Partial Recombinant Protein (H00005307-Q01) (0)

There are no publications for PITX1 Partial Recombinant Protein (H00005307-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PITX1 Partial Recombinant Protein (H00005307-Q01) (0)

There are no reviews for PITX1 Partial Recombinant Protein (H00005307-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PITX1 Partial Recombinant Protein (H00005307-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PITX1 Products

Bioinformatics Tool for PITX1 Partial Recombinant Protein (H00005307-Q01)

Discover related pathways, diseases and genes to PITX1 Partial Recombinant Protein (H00005307-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PITX1 Partial Recombinant Protein (H00005307-Q01)

Discover more about diseases related to PITX1 Partial Recombinant Protein (H00005307-Q01).
 

Pathways for PITX1 Partial Recombinant Protein (H00005307-Q01)

View related products by pathway.

PTMs for PITX1 Partial Recombinant Protein (H00005307-Q01)

Learn more about PTMs related to PITX1 Partial Recombinant Protein (H00005307-Q01).

Blogs on PITX1

There are no specific blogs for PITX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PITX1 Antibody
NBP1-88644
FGF-8 [Unconjugated]
423-F8-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PITX1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PITX1