PIRT Antibody

Images

 
Immunohistochemistry: PIRT Antibody [NBP1-90968] - Immunohistochemical staining of human cerebral cortex shows positivity in neuropil.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIRT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIRT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PIRT Protein (NBP1-90968PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIRT Antibody

  • phosphoinositide-interacting protein
  • phosphoinositide-interacting regulator of transient receptor potential channels
  • phosphoinositide-interacting regulator of TRPV1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004810-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB6967
Species: Hu
Applications: WB
H00006326-Q01
Species: Hu
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NBP1-92440
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-20089
Species: Hu
Applications: WB, ICC/IF
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-88525
Species: Hu
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-32887
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90968
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PIRT Antibody (NBP1-90968) (0)

There are no publications for PIRT Antibody (NBP1-90968).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIRT Antibody (NBP1-90968) (0)

There are no reviews for PIRT Antibody (NBP1-90968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PIRT Antibody (NBP1-90968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIRT Products

Bioinformatics Tool for PIRT Antibody (NBP1-90968)

Discover related pathways, diseases and genes to PIRT Antibody (NBP1-90968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIRT Antibody (NBP1-90968)

Discover more about diseases related to PIRT Antibody (NBP1-90968).
 

Pathways for PIRT Antibody (NBP1-90968)

View related products by pathway.

PTMs for PIRT Antibody (NBP1-90968)

Learn more about PTMs related to PIRT Antibody (NBP1-90968).

Blogs on PIRT

There are no specific blogs for PIRT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIRT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIRT