PIP5K2B Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIP5K2B. Source: E. coli Amino Acid Sequence: PDSPGNLLSFPRFFGPGEFDPSVDVYAMKSH Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PIP4K2B |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56946. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for PIP5K2B Recombinant Protein Antigen
Background
PIP5K2B, also known as Phosphatidylinositol 5-phosphate 4-kinase type-2 beta, has a 416 amino acid long isoform that is approximately 47 kDa and a short 281 amino acid isoform that is approximately 32 kDa. PIP5K2B interacts with p55 TNF receptor and is implicated in the biosynthesis of PIP2, which is a phospholipid component of the plasma membrane. Current research on PIP5K2B is being conducted in relation to several diseases and disorders including breast cancer and ataxia. Research has shown that PIP5K2B has interactions with BTK, RAC1, RNPS1, UBQLN4 and TNF Receptor I in pathways such as calcium signaling, cAMP signaling, regulation of actin cytoskeleton, and Inositol phosphate metabolism.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IP (-), WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, KD, WB
Species: Hu, Pm, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P
Species: Hu
Applications: AC
Publications for PIP5K2B Recombinant Protein Antigen (NBP2-56946PEP) (0)
There are no publications for PIP5K2B Recombinant Protein Antigen (NBP2-56946PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PIP5K2B Recombinant Protein Antigen (NBP2-56946PEP) (0)
There are no reviews for PIP5K2B Recombinant Protein Antigen (NBP2-56946PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for PIP5K2B Recombinant Protein Antigen (NBP2-56946PEP) (0)
Additional PIP5K2B Products
Research Areas for PIP5K2B Recombinant Protein Antigen (NBP2-56946PEP)
Find related products by research area.
|
Blogs on PIP5K2B