Recombinant Human PIK3C2G Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PIK3C2G Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 2 - 100 of Human PIK3C2G partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AYSWQTDPNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PIK3C2G

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PIK3C2G Protein

  • EC 2.7.1
  • EC 2.7.1.154
  • MGC163149
  • phosphatidylinositol 3-kinase C2 domain-containing gamma
  • phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing gammapolypeptide
  • phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit gamma
  • Phosphoinositide 3-kinase-C2-gamma
  • phosphoinositide-3-kinase, class 2, gamma polypeptide
  • PI3K-C2GAMMA
  • PI3K-C2-gamma
  • PTDINS-3-kinase C2 gamma
  • PtdIns-3-kinase C2 subunit gamma

Background

PIK3C2G - phosphoinositide-3-kinase, class 2, gamma polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46402
Species: Hu
Applications: WB, IHC
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-03459
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46395
Species: Hu
Applications: WB, IHC
AF5639
Species: Hu, Mu
Applications: WB, ICC
NBP2-46403
Species: Hu
Applications: IHC
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP1-86267
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-184
Species: Hu, Mu
Applications: WB, IP
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP2-37422
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-57995
Species: Hu
Applications: ICC/IF
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005288-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PIK3C2G Partial Recombinant Protein (H00005288-Q01) (0)

There are no publications for PIK3C2G Partial Recombinant Protein (H00005288-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIK3C2G Partial Recombinant Protein (H00005288-Q01) (0)

There are no reviews for PIK3C2G Partial Recombinant Protein (H00005288-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIK3C2G Partial Recombinant Protein (H00005288-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIK3C2G Products

Bioinformatics Tool for PIK3C2G Partial Recombinant Protein (H00005288-Q01)

Discover related pathways, diseases and genes to PIK3C2G Partial Recombinant Protein (H00005288-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIK3C2G Partial Recombinant Protein (H00005288-Q01)

Discover more about diseases related to PIK3C2G Partial Recombinant Protein (H00005288-Q01).
 

Pathways for PIK3C2G Partial Recombinant Protein (H00005288-Q01)

View related products by pathway.

Research Areas for PIK3C2G Partial Recombinant Protein (H00005288-Q01)

Find related products by research area.

Blogs on PIK3C2G

There are no specific blogs for PIK3C2G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PIK3C2G RNAi
H00005288-R02-20nmol

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PIK3C2G Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3C2G