PIGM Antibody - BSA Free

Immunohistochemistry-Paraffin: PIGM Antibody [NBP2-13761] - Staining of human cerebellum shows cytoplasmic positivity in Purkinje cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PIGM Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYT
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIGM
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PIGM Protein (NBP2-13761PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PIGM Antibody - BSA Free

• EC 2.4.1
• EC 2.4.1.-
• GPI mannosyltransferase 1
• GPI mannosyltransferase I
• GPI-MT-IPIG-M mannosyltransferase
• MGC29896
• phosphatidylinositol glycan anchor biosynthesis, class M
• phosphatidylinositol glycan, class M
• Phosphatidylinositol-glycan biosynthesis class M protein
• PIG-M

Background

PIGM, also known as GPI mannosyltransferase 1, is 423 amino acids long and approximately 49 kDa. PIGM is implicated in the assembly of precursors for GPI biosynthesis. PIGL research is currently being conducted in relation to several diseases and disorders such as malaria, thrombosis and babesiosis. PIGM has been shown to have interactions with ACTB, ACTG1, ALDH3A1, GIPC1 and PIGX in pathways such as GPI anchor biosynthesis and metabolic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIGM