Recombinant Human PIGL Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PIGL Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-252 of Human PIGL full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHWVYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGINLVVTFDAGGVSGHSNHIALYAAVRALHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPLSLLHTQDVLFVLNSKEVAQAKKAMSCHRSQLLWFRRLYIIFSRYMRINSLSFL

Protein/Peptide Type
Recombinant Protein
Gene
PIGL

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PIGL Protein

  • EC 3.5.1.89
  • N-acetylglucosaminylphosphatidylinositol deacetylase
  • N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
  • phosphatidylinositol glycan anchor biosynthesis, class L
  • phosphatidylinositol glycan, class L
  • Phosphatidylinositol-glycan biosynthesis class L protein
  • PIG-L

Background

This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13760
Species: Hu
Applications: IHC, IHC-P
NBP1-86283
Species: Hu
Applications: WB, IHC, IHC-P
NB110-40561
Species: Hu
Applications: WB, IP
AF7637
Species: Hu
Applications: WB
H00009091-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-05034
Species: Hu
Applications: WB, PEP-ELISA
NBP1-31564
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Other, Pm, Rb
Applications: WB, Flow
NBP1-81706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-62449
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB100-1481
Species: Hu
Applications: WB, PEP-ELISA
NB500-330
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready

Publications for PIGL Recombinant Protein (H00009487-P01) (0)

There are no publications for PIGL Recombinant Protein (H00009487-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGL Recombinant Protein (H00009487-P01) (0)

There are no reviews for PIGL Recombinant Protein (H00009487-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGL Recombinant Protein (H00009487-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIGL Products

Bioinformatics Tool for PIGL Recombinant Protein (H00009487-P01)

Discover related pathways, diseases and genes to PIGL Recombinant Protein (H00009487-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGL Recombinant Protein (H00009487-P01)

Discover more about diseases related to PIGL Recombinant Protein (H00009487-P01).
 

Pathways for PIGL Recombinant Protein (H00009487-P01)

View related products by pathway.

PTMs for PIGL Recombinant Protein (H00009487-P01)

Learn more about PTMs related to PIGL Recombinant Protein (H00009487-P01).

Blogs on PIGL

There are no specific blogs for PIGL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PIGL Antibody
NBP1-86471

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PIGL Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGL