PIGA Recombinant Protein Antigen

Images

 
There are currently no images for PIGA Protein (NBP2-13760PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PIGA Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIGA.

Source: E. coli

Amino Acid Sequence: FADVSSVLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKGIDLLSGIIPELCQKYPDLNFIIGGEGPKRII

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PIGA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13760.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PIGA Recombinant Protein Antigen

  • class A GlcNAc-inositol phospholipid assembly protein
  • EC 2.4.1.198
  • GlcNAc-PI synthesis protein
  • GPI anchor biosynthesis
  • GPI3
  • phosphatidylinositol glycan anchor biosynthesis, class A
  • phosphatidylinositol glycan, class A (paroxysmal nocturnal hemoglobinuria)
  • phosphatidylinositol N-acetylglucosaminyltransferase subunit A
  • Phosphatidylinositol-glycan biosynthesis class A protein
  • phosphatidylinositol-glycan biosynthesis, class A protein
  • PIG-A

Background

PIGA, also known as Phosphatidylinositol N-acetylglucosaminyltransferase subunit A, has three isoforms that are produced by alternative splicing. Isoform 1, the canonical sequence, is 484 amino acids long and 54 kDa. Isoform 2 and 3 are both shorter isoforms, at 315 and 250 amino acids, respectively. PIGA is a critical player in the synthesis of N-acetylglucosaminyl-phosphatidylinositol, which is the first intermediate in the biosynthesis of GPI anchors. Current research on PIGA is being conducted in relation to several diseases and disorders including Paroxysmal nocturnal hemoglobinuria, which may be caused by mutations in the PIGA gene. Other diseases and disorders related to PIGA include multiple congenital anomalies-hypotonia-seizures syndrome type 2, anemia, Burkitt's lymphoma, hepatic vein thrombosis and Myelodysplastic syndrome. PIGA has been shown to have interactions with DPM2, PIGQ, PIGH, PYURF and PIGP in pathways such as GPI anchor biosynthesis and metabolic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-330
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr,  IHC-P, IP
AF2009
Species: Hu
Applications: ICC, IHC
NBP1-86283
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
H00009091-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
AF4117
Species: Rt
Applications: IHC, WB
NBP1-83342
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, Simple Western, WB
NBP1-85856
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
2150-C5
Species: Mu
Applications: BA
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF482
Species: Mu
Applications: IHC, WB
AF3327
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, WB
NBP2-13760PEP
Species: Hu
Applications: AC

Publications for PIGA Protein (NBP2-13760PEP) (0)

There are no publications for PIGA Protein (NBP2-13760PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGA Protein (NBP2-13760PEP) (0)

There are no reviews for PIGA Protein (NBP2-13760PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PIGA Protein (NBP2-13760PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIGA Products

Array NBP2-13760PEP

Research Areas for PIGA Protein (NBP2-13760PEP)

Find related products by research area.

Blogs on PIGA

There are no specific blogs for PIGA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PIGA Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGA