PIGA Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIGA. Source: E. coli
Amino Acid Sequence: FADVSSVLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKGIDLLSGIIPELCQKYPDLNFIIGGEGPKRII Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PIGA |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13760. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for PIGA Recombinant Protein Antigen
Background
PIGA, also known as Phosphatidylinositol N-acetylglucosaminyltransferase subunit A, has three isoforms that are produced by alternative splicing. Isoform 1, the canonical sequence, is 484 amino acids long and 54 kDa. Isoform 2 and 3 are both shorter isoforms, at 315 and 250 amino acids, respectively. PIGA is a critical player in the synthesis of N-acetylglucosaminyl-phosphatidylinositol, which is the first intermediate in the biosynthesis of GPI anchors. Current research on PIGA is being conducted in relation to several diseases and disorders including Paroxysmal nocturnal hemoglobinuria, which may be caused by mutations in the PIGA gene. Other diseases and disorders related to PIGA include multiple congenital anomalies-hypotonia-seizures syndrome type 2, anemia, Burkitt's lymphoma, hepatic vein thrombosis and Myelodysplastic syndrome. PIGA has been shown to have interactions with DPM2, PIGQ, PIGH, PYURF and PIGP in pathways such as GPI anchor biosynthesis and metabolic pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, WB
Species: Hu
Applications: AC
Publications for PIGA Protein (NBP2-13760PEP) (0)
There are no publications for PIGA Protein (NBP2-13760PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PIGA Protein (NBP2-13760PEP) (0)
There are no reviews for PIGA Protein (NBP2-13760PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for PIGA Protein (NBP2-13760PEP) (0)
Additional PIGA Products
Research Areas for PIGA Protein (NBP2-13760PEP)
Find related products by research area.
|
Blogs on PIGA