PI 3-Kinase C2 beta Recombinant Protein Antigen

Images

 
There are currently no images for PI 3-Kinase C2 beta Recombinant Protein Antigen (NBP2-58352PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PI 3-Kinase C2 beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PI 3-Kinase C2 beta.

Source: E. coli

Amino Acid Sequence: PHTVANGHELFEVSEERDEEVAAFCHMLDILRSGSDIQDYFLTGYVWSAVTPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PIK3C2B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58352.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PI 3-Kinase C2 beta Recombinant Protein Antigen

  • C2-PI3K
  • C2-PI3KDKFZp686G16234
  • EC 2.7.1
  • EC 2.7.1.154
  • phosphatidylinositol 3-kinase C2 domain-containing beta polypeptide
  • phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta
  • Phosphoinositide 3-kinase-C2-beta
  • phosphoinositide-3-kinase, class 2, beta polypeptide
  • PI 3Kinase C2 beta
  • PI 3-Kinase C2 beta
  • PI3K-C2beta
  • PI3K-C2-beta
  • PIK3C2B
  • PTDINS-3-kinase C2 beta
  • PtdIns-3-kinase C2 subunit beta

Background

PIK3C2B is encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is sensitive to low nanomolar levels of the inhibitor wortmanin. The C2 domain of this protein was shown to bind phospholipids but not Ca2+, which suggests that this enzyme may function in a calcium-independent manner.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-46395
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-33694
Species: Hu
Applications: IHC,  IHC-P
NB100-556
Species: Hu
Applications: IP, WB
AF1244
Species: Hu, Mu, Rt
Applications: IHC, WB
291-G1
Species: Hu
Applications: BA
MAB6777
Species: Hu
Applications: ICC, WB
NBP2-02434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF3846
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-74648
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB

Publications for PI 3-Kinase C2 beta Recombinant Protein Antigen (NBP2-58352PEP) (0)

There are no publications for PI 3-Kinase C2 beta Recombinant Protein Antigen (NBP2-58352PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PI 3-Kinase C2 beta Recombinant Protein Antigen (NBP2-58352PEP) (0)

There are no reviews for PI 3-Kinase C2 beta Recombinant Protein Antigen (NBP2-58352PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PI 3-Kinase C2 beta Recombinant Protein Antigen (NBP2-58352PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PI 3-Kinase C2 beta Products

Blogs on PI 3-Kinase C2 beta

There are no specific blogs for PI 3-Kinase C2 beta, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PI 3-Kinase C2 beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3C2B