PHYHIPL Antibody

Images

 
Western Blot: PHYHIPL Antibody [NBP1-68963] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHYHIPL Antibody Summary

Immunogen
Synthetic peptides corresponding to PHYHIPL (phytanoyl-CoA 2-hydroxylase interacting protein-like) The peptide sequence was selected from the C terminal of PHYHIPL. Peptide sequence QDVILEVIYTDPVDLSVGTVAEITGHQLMSLSTANAKKDPSCKTCNISVG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHYHIPL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PHYHIPL and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PHYHIPL Antibody

  • Em:AC025038.1
  • KIAA1796phytanoyl-CoA hydroxylase interacting protein-like
  • phytanoyl-CoA 2-hydroxylase interacting protein-like
  • phytanoyl-CoA hydroxylase-interacting protein-like

Background

PHYHIPL may play a role in the development of the central system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-58831
Species: Hu
Applications: WB, ICC/IF
NBP1-88888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33021
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00004722-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
NBP1-86391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88039
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
H00003304-M02
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP1-68963
Species: Hu
Applications: WB

Publications for PHYHIPL Antibody (NBP1-68963) (0)

There are no publications for PHYHIPL Antibody (NBP1-68963).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHYHIPL Antibody (NBP1-68963) (0)

There are no reviews for PHYHIPL Antibody (NBP1-68963). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHYHIPL Antibody (NBP1-68963) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHYHIPL Products

Bioinformatics Tool for PHYHIPL Antibody (NBP1-68963)

Discover related pathways, diseases and genes to PHYHIPL Antibody (NBP1-68963). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHYHIPL Antibody (NBP1-68963)

Discover more about diseases related to PHYHIPL Antibody (NBP1-68963).

Blogs on PHYHIPL

There are no specific blogs for PHYHIPL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHYHIPL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHYHIPL
Uniprot