PHOX2B Recombinant Protein Antigen

Images

 
There are currently no images for PHOX2B Recombinant Protein Antigen (NBP2-68991PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PHOX2B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PHOX2B.

Source: E.coli

Amino Acid Sequence: MEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTLRDHQS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PHOX2B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68991. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PHOX2B Recombinant Protein Antigen

  • NBPhox
  • NBPhoxPhox2b
  • Neuroblastoma Phox
  • paired mesoderm homeobox 2b
  • paired mesoderm homeobox protein 2B
  • paired-like homeobox 2bNBLST2
  • PHOX2B homeodomain protein
  • PHOX2B
  • PMX2B
  • PMX2Bneuroblastoma paired-type homeobox protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000401-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, RNAi
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2567
Species: Mu
Applications: WB, IHC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt, KO
AF482
Species: Mu
Applications: WB, IHC
NLS54
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
AF3876
Species: Hu, Mu
Applications: WB, IHC
NBP2-82023
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
AF755
Species: Mu
Applications: WB, Block
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-82554
Species: Hu, Mu, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF4210
Species: Hu
Applications: WB, IHC
NBP2-46640
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PHOX2B Recombinant Protein Antigen (NBP2-68991PEP) (0)

There are no publications for PHOX2B Recombinant Protein Antigen (NBP2-68991PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHOX2B Recombinant Protein Antigen (NBP2-68991PEP) (0)

There are no reviews for PHOX2B Recombinant Protein Antigen (NBP2-68991PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PHOX2B Recombinant Protein Antigen (NBP2-68991PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional PHOX2B Products

Array NBP2-68991PEP

Bioinformatics Tool for PHOX2B Recombinant Protein Antigen (NBP2-68991PEP)

Discover related pathways, diseases and genes to PHOX2B Recombinant Protein Antigen (NBP2-68991PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHOX2B Recombinant Protein Antigen (NBP2-68991PEP)

Discover more about diseases related to PHOX2B Recombinant Protein Antigen (NBP2-68991PEP).
 

Pathways for PHOX2B Recombinant Protein Antigen (NBP2-68991PEP)

View related products by pathway.

PTMs for PHOX2B Recombinant Protein Antigen (NBP2-68991PEP)

Learn more about PTMs related to PHOX2B Recombinant Protein Antigen (NBP2-68991PEP).
 

Research Areas for PHOX2B Recombinant Protein Antigen (NBP2-68991PEP)

Find related products by research area.

Blogs on PHOX2B

There are no specific blogs for PHOX2B, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PHOX2B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PHOX2B
Novus 100% Guarantee