We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PHOX2B Recombinant Protein Antigen

Images

 
There are currently no images for PHOX2B Recombinant Protein Antigen (NBP2-57536PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PHOX2B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PHOX2B.

Source: E. coli

Amino Acid Sequence: GPGQGWAPGPGPITSIPDSLGGPFASVLSSLQRPN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PHOX2B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57536.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PHOX2B Recombinant Protein Antigen

  • NBPhox
  • NBPhoxPhox2b
  • Neuroblastoma Phox
  • paired mesoderm homeobox 2b
  • paired mesoderm homeobox protein 2B
  • paired-like homeobox 2bNBLST2
  • PHOX2B homeodomain protein
  • PHOX2B
  • PMX2B
  • PMX2Bneuroblastoma paired-type homeobox protein

Background

The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription factor involved in the development of several major noradrenergic neuron populations and the determination of neurotransmitter phenotype. The gene product is linked to enhancement of second messenger-mediated activation of the dopamine beta-hydroylase, c-fos promoters and several enhancers, including cyclic amp-response element and serum-response element. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56644
Species: Hu
Applications: ICC/IF
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-31386
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-14738
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
AF482
Species: Mu
Applications: IHC, WB
NLS54
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3876
Species: Hu, Mu
Applications: IHC, WB
AF2864
Species: Hu
Applications: ICC, IHC, WB
212-GD
Species: Hu
Applications: Bind, BA
NBP2-82023
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF755
Species: Mu
Applications: Block, WB
NBP1-80992
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82554
Species: Hu
Applications: ChIP, IHC,  IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF4210
Species: Hu
Applications: IHC, Simple Western, WB
314-BP
Species: Hu
Applications: BA, BA
NBP2-59330
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB

Publications for PHOX2B Recombinant Protein Antigen (NBP2-57536PEP) (0)

There are no publications for PHOX2B Recombinant Protein Antigen (NBP2-57536PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHOX2B Recombinant Protein Antigen (NBP2-57536PEP) (0)

There are no reviews for PHOX2B Recombinant Protein Antigen (NBP2-57536PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PHOX2B Recombinant Protein Antigen (NBP2-57536PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHOX2B Products

Array NBP2-57536PEP

Research Areas for PHOX2B Recombinant Protein Antigen (NBP2-57536PEP)

Find related products by research area.

Blogs on PHOX2B

There are no specific blogs for PHOX2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PHOX2B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PHOX2B