Recombinant Human PHOX2A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PHOX2A Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 90 of Human PHOX2A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PHOX2A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PHOX2A Protein

  • aristaless (Drosophila) homeobox, aristaless homeobox (Drosophila), fibrosis ofextraocular muscles, congenital, 2, autosomal recessive
  • aristaless homeobox homolog
  • Aristaless homeobox protein homolog
  • arix homeodomain protein
  • ARIX1 homeodomain protein
  • ARIXNCAM2
  • CFEOM2MGC52227
  • paired mesoderm homeobox protein 2A
  • paired-like homeobox 2apaired-like (aristaless) homeobox 2a
  • PMX2AFEOM2

Background

PHOX2A - paired-like (aristaless) homeobox 2a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4940
Species: Hu, Mu
Applications: ICC
NBP2-37969
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
AF2567
Species: Mu
Applications: WB, IHC
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
355-BM/CF
Species: Hu, Mu, Rt
AF3876
Species: Hu, Mu
Applications: WB, IHC
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
25280002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00000401-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PHOX2A Partial Recombinant Protein (H00000401-Q01) (0)

There are no publications for PHOX2A Partial Recombinant Protein (H00000401-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHOX2A Partial Recombinant Protein (H00000401-Q01) (0)

There are no reviews for PHOX2A Partial Recombinant Protein (H00000401-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHOX2A Partial Recombinant Protein (H00000401-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHOX2A Products

Bioinformatics Tool for PHOX2A Partial Recombinant Protein (H00000401-Q01)

Discover related pathways, diseases and genes to PHOX2A Partial Recombinant Protein (H00000401-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHOX2A Partial Recombinant Protein (H00000401-Q01)

Discover more about diseases related to PHOX2A Partial Recombinant Protein (H00000401-Q01).
 

Pathways for PHOX2A Partial Recombinant Protein (H00000401-Q01)

View related products by pathway.

PTMs for PHOX2A Partial Recombinant Protein (H00000401-Q01)

Learn more about PTMs related to PHOX2A Partial Recombinant Protein (H00000401-Q01).
 

Research Areas for PHOX2A Partial Recombinant Protein (H00000401-Q01)

Find related products by research area.

Blogs on PHOX2A

There are no specific blogs for PHOX2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-2 [Unconjugated]
355-BM-010/CF
PHOX2A Antibody
NBP2-41169

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PHOX2A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PHOX2A