Phospholipase C delta 1 Antibody

Images

 
Immunohistochemistry: Phospholipase C delta 1 Antibody [NBP1-87557] - Staining of human testis shows cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Phospholipase C delta 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EAFYKMLTQRVEIDRTFAEAAGSGETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLCD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Phospholipase C delta 1 Protein (NBP1-87557PEP)
Publications
Read Publication using NBP1-87557.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Phospholipase C delta 1 Antibody

  • 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-1
  • EC 3.1.4.11
  • Phosphoinositide phospholipase C-delta-1
  • phospholipase C, delta 1
  • Phospholipase C-delta-1
  • Phospholipase C-III
  • PLC-delta-1
  • PLC-III

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2364
Species: Hu
Applications: WB, IHC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF4466
Species: Hu, Mu
Applications: WB
NBP2-52532
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF5315
Species: Hu, Mu
Applications: WB
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP2-38393
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005330-M03
Species: Hu
Applications: ELISA, ICC/IF

Publications for Phospholipase C delta 1 Antibody (NBP1-87557)(1)


Reviews for Phospholipase C delta 1 Antibody (NBP1-87557) (0)

There are no reviews for Phospholipase C delta 1 Antibody (NBP1-87557). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Phospholipase C delta 1 Antibody (NBP1-87557) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Phospholipase C delta 1 Products

Bioinformatics Tool for Phospholipase C delta 1 Antibody (NBP1-87557)

Discover related pathways, diseases and genes to Phospholipase C delta 1 Antibody (NBP1-87557). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phospholipase C delta 1 Antibody (NBP1-87557)

Discover more about diseases related to Phospholipase C delta 1 Antibody (NBP1-87557).
 

Pathways for Phospholipase C delta 1 Antibody (NBP1-87557)

View related products by pathway.

PTMs for Phospholipase C delta 1 Antibody (NBP1-87557)

Learn more about PTMs related to Phospholipase C delta 1 Antibody (NBP1-87557).
 

Research Areas for Phospholipase C delta 1 Antibody (NBP1-87557)

Find related products by research area.

Blogs on Phospholipase C delta 1

There are no specific blogs for Phospholipase C delta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phospholipase C delta 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCD1