Phospholemman Antibody

Images

 
Western Blot: Phospholemman Antibody [NBP1-79193] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Phospholemman Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human FXYD1. Peptide sequence ASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FXYD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against FXYD1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Phospholemman Antibody

  • FXYD domain containing ion transport regulator 1
  • FXYD domain-containing ion transport regulator 1
  • MGC44983
  • PLMphospholemman

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48725
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56483
Species: Hu
Applications: ICC/IF
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
H00010926-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-01991
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000486-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-86404
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF6387
Species: Hu
Applications: WB
NB300-146
Species: Hu, Mu, Rt, Po, Bv, Ca, Dr, GP, Pm, Rb, Xp, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC

Publications for Phospholemman Antibody (NBP1-79193) (0)

There are no publications for Phospholemman Antibody (NBP1-79193).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phospholemman Antibody (NBP1-79193) (0)

There are no reviews for Phospholemman Antibody (NBP1-79193). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Phospholemman Antibody (NBP1-79193) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Phospholemman Antibody (NBP1-79193)

Discover related pathways, diseases and genes to Phospholemman Antibody (NBP1-79193). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phospholemman Antibody (NBP1-79193)

Discover more about diseases related to Phospholemman Antibody (NBP1-79193).
 

Pathways for Phospholemman Antibody (NBP1-79193)

View related products by pathway.

PTMs for Phospholemman Antibody (NBP1-79193)

Learn more about PTMs related to Phospholemman Antibody (NBP1-79193).

Blogs on Phospholemman

There are no specific blogs for Phospholemman, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phospholemman Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FXYD1
Uniprot