Phospholemman Antibody - BSA Free Summary
Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen |
Synthetic peptide directed towards the N terminal of human FXYD1. Peptide sequence ASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILG. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FXYD1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Phospholemman Antibody - BSA Free
Background
Phospholemman encodes a member of the FXYD family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The protein encoded by this gene is a plasma membrane substrate for several kinases, including protein kinase A, protein kinase C, NIMA kinase, and myotonic dystrophy kinase. It is thought to form an ion channel or regulate ion channel activity and act as an accessory protein of Na,K-ATPase. Alternative splicing of this gene results in multiple transcript variants which encode the same protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, ELISA(Cap), S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Ca, Dr, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh, Xp, Ye
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu, Rt
Applications: WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC
Publications for Phospholemman Antibody (NBP1-79193) (0)
There are no publications for Phospholemman Antibody (NBP1-79193).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Phospholemman Antibody (NBP1-79193) (0)
There are no reviews for Phospholemman Antibody (NBP1-79193).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Phospholemman Antibody (NBP1-79193) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Phospholemman Products
Research Areas for Phospholemman Antibody (NBP1-79193)
Find related products by research area.
|
Blogs on Phospholemman